KEGG   Canis familiaris (dog): 479077Help
Entry
479077            CDS       T01007                                 

Gene name
NSD2
Definition
(RefSeq) LOW QUALITY PROTEIN: histone-lysine N-methyltransferase NSD2
  KO
K11424  histone-lysine N-methyltransferase NSD2 [EC:2.1.1.43]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00310  Lysine degradation
cfa05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    479077 (NSD2)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    479077 (NSD2)
Enzymes [BR:cfa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     479077 (NSD2)
Chromosome and associated proteins [BR:cfa03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     479077 (NSD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PWWP SET PHD HMG_box HMG_box_2 zf-HC5HC2H zf-HC5HC2H_2
Motif
Other DBs
NCBI-GeneID: 479077
NCBI-ProteinID: XP_536224
Ensembl: ENSCAFG00000014951
VGNC: 43981
LinkDB All DBs
Position
3
AA seq 1364 aa AA seqDB search
MEFSIKXNPLSVQKVVECIKMKQAPEILGNTNGKTQNCEVNRECSVFLSKAHLSTSLQEG
VMQKFNGHDALPFIPSEKLKDLTSRVFNGEPGAHDAKLRFESQEGKGLGTPPNTTPIKNG
SPEIKLKITKTYMNGKPLFESSICGDGAAAVSQSEENGQKAENKARRSRKRSIKYDSFLE
QGLVEAALVSKISSPSDKKIAAKKESCPNTGRDKDHLLKYNVGDLVWSKVSGYPWWPCMV
SADPLLHNYTKLKGQKKSARQYHVQFFGDAPERAWIFEKSLVAFEGEGQFEKLCQESAKQ
APTKAEKIKLLKPISGKLRAQWEMGIVQAEEAASMSIEERKAKFTFLYVGDQLHLNPHVA
KEASIAVESPAQVVESSGVIEEAADNPKSLREEGIPIKRRRRAKLSGSAENQESEPGTVK
STPQKVAEADPKRGVGCPPGRKKSVASTPRSRKGDAASRFLVFCQKHRDEVVAEHPDASG
EEIEELLGSQWDMLNEKQKARYNTKFALVASSQSEEDSGNINGKKRIHTKRTQEPTEDAD
GEDAPRKRLRTDKHGLRKRETINDKTARTSSCKAIEAASSLKSQAATKHLSDACKPLKKR
NRASTAASSTPFSKSSSPSASLTENEVSDGPGDEPLESPYESADETQTEVSISSKKSERG
VTAKKEYVCQLCEKTGSLVLCEGPCCGAFHLACLGLSRRPEGRFTCSECASGIHSCFVCK
ESKTDVKRCVVSQCGKFYHEACVRKYPLAVFESRGFRCPLHSCVSCHASNPSNPRPSKGK
MMRCVRCPVAYHGGDACLAAGCSVIASNSIICTGHFTARKGKRHHAHVNVSWCFVCSKGG
SLLCCESCPAAFHPDCLNIDMPDGSWFCNDCRAGKRLHFQDIIWVKLGNYRWWPAEVCHP
KNVPPNIQNLKHEIGEFPVFFFGSKDYYWTHQARVFPYMEGDRGSRYQGVRGIGRVFKNA
LQEAEARFREIKLQREARETQENERKPPPYKHIKVNKPYGKVQIYTADISEIPKCNCKPT
DENPCGFDSECLNRMLMFECHPQVCPAGEYCQNQCFTKRQYPETKIIKTDGKGWGLVAKR
DIRKGEFVNEYVGELIDEEECMARIKYAHENDITHFYMLTIDKDRIIDAGPKGNYSRFMN
HSCQPNCETLKWTVNGDTRVGLFAVCDIPAGTELTFNYNLDCLGNEKTVCRCGASNCSGF
LGDRPKTSASLSSDEKGKKTKKRTRRRRTRGEGKKESEDECFRCGDGGQLVLCDRKSCTK
AYHLSCLGLGKRPFGKWECPWHHCDVCGKPSTSFCHFCPNSFCKEHQDGTAFSSTQDGRS
YCYEHDLGAESARSTKTEKPFPEPMKSKGKRKKRRCWRRVTEGK
NT seq 4095 nt NT seq  +upstreamnt  +downstreamnt
atggaatttagcatcaaanaaaatcctctttctgttcagaaagttgtagagtgcataaag
atgaagcaggcaccagaaatccttggcaatacaaacggaaagactcagaactgtgaagtg
aatcgtgaatgttctgtattcctcagcaaagcccacctctctaccagtctgcaggagggg
gtcatgcaaaaatttaatggccacgatgcccttccctttattccatctgagaagctgaaa
gatctaacttcccgtgtatttaatggagaacctggtgctcatgatgccaaattacgtttt
gagtcacaggaagggaaaggacttgggacaccgcctaacaccacccctatcaaaaatggc
tctccggagattaagctgaagatcaccaaaacatacatgaatgggaaacctctctttgaa
tcttcaatttgtggtgacggtgctgctgctgtatcccagtcagaagaaaatggacaaaaa
gcagaaaataaagcaagaaggagcaggaagagaagcataaaatacgactccttcctggag
cagggtcttgtcgaagcagcactggtgtccaagatctcaagtccctcagataaaaagatt
gcagctaagaaagagtcctgtccaaatactggcagagataaagaccacctgttgaaatat
aatgtcggtgatttggtgtggtccaaagtgtccggttacccttggtggccatgcatggtt
tctgctgatccactccttcacaactataccaaacttaaaggtcagaaaaagagtgcacgc
cagtatcacgtacagttctttggtgatgccccagaaagagcttggatatttgagaagagc
cttgtagcttttgaaggagaaggacagtttgaaaaattatgccaggaaagtgccaagcag
gcacccacgaaagctgagaaaattaagctgttgaaacctatttcagggaaattgagggcc
cagtgggaaatgggcattgttcaagcagaagaagctgcaagcatgtccatagaggaacgg
aaagctaagttcacttttctctatgtgggggaccagcttcacctcaaccctcatgtagct
aaggaggcaagcattgctgtggagtctccggcacaagtggtagaatcctcaggagtcatt
gaagaagctgctgataaccccaagtccctgagagaagagggcattcccatcaagagaagg
cggagagccaagctgtctggctctgccgaaaaccaagaaagtgagcctgggacagtaaag
agtactcctcagaaggtggcagaagctgaccccaagagaggagttgggtgtcctcctgga
aggaagaagagcgtggcctccactccacggagcaggaagggagatgcagcatcccggttt
ttggtcttctgtcagaagcacagggatgaggttgttgctgagcacccagacgcctcaggt
gaggagattgaagagctgcttggatcccagtgggacatgctcaacgagaaacagaaagca
cgctataacacaaagtttgccctagtggcctcttcccaatctgaagaagactctggtaac
atcaatgggaaaaaaagaatccacacaaagaggacacaggagcctactgaagacgctgac
ggcgaagatgcacccaggaagagactcaggaccgacaagcacggtcttcggaagagagag
acgatcaatgacaagacagcccgaacaagctcctgcaaggccatcgaggcagcctcctca
ctcaagagccaggcagcaacgaaacatctgtcagatgcatgcaaaccactgaagaagcgg
aatcgggcatccacagcagcgtcttctactccttttagcaaaagttcatctccttctgca
tccttaactgagaatgaggtgtcagatggcccaggagacgagcccttggagtccccgtat
gagagcgcagatgaaactcagaccgaagtgtccatctcgtctaagaagtctgagcgagga
gtaaccgccaaaaaggagtacgtgtgtcagctgtgtgagaagacgggcagtcttgtgctc
tgtgagggcccctgctgtggagctttccacctcgcttgccttggcctttcccggaggcca
gaagggaggttcacttgcagcgaatgtgcttcagggattcactcatgttttgtgtgtaag
gagagcaagacagatgtgaagcgctgtgtcgtatcgcagtgtgggaagttttaccatgaa
gcttgcgtgaggaagtaccctctggctgtgtttgagagccgaggcttccgctgccccctc
cacagctgcgtgagctgccatgcttccaatccttccaacccaagaccatcgaaaggtaaa
atgatgcgatgtgtccgctgccctgtcgcctatcatggaggggatgcttgtctggcagct
ggctgctcggtgatagcttccaacagcatcatctgcacgggccatttcactgctcgcaag
gggaagagacatcatgctcatgtcaatgtgagctggtgttttgtgtgctccaaaggggga
agcctcctatgctgcgagtcctgcccagccgccttccaccctgactgcctgaacatcgac
atgcctgatggcagctggttctgcaatgactgccgggcagggaagaggctgcacttccag
gacatcatctgggtgaagctcggcaactacagatggtggccggcagaagtttgccatccc
aaaaatgtccccccaaatattcagaacctgaagcacgagattggagagttccctgtgttt
ttctttgggtctaaagattattactggacgcatcaggcgcgagtgttcccgtacatggag
ggggaccggggcagccgctaccagggggtcagagggatcggaagagtcttcaaaaacgca
ctgcaggaagctgaagctcgatttcgtgaaatcaaacttcaaagggaagccagagaaaca
caggagaatgagcgcaagcccccgccatacaagcatatcaaggtgaataagccttatggg
aaagtccagatctatacagctgatatttctgaaatcccgaagtgcaactgtaagcccaca
gatgagaatccgtgtggctttgattcggagtgtttgaacaggatgctgatgtttgagtgc
cacccgcaggtgtgtcctgcaggcgaatactgccagaaccaatgtttcaccaagcgccaa
taccccgagaccaagatcatcaagacagatggcaaaggttggggcctggtggccaagcgg
gacatcagaaagggagaatttgtgaacgagtatgttggagagctgattgacgaggaggag
tgcatggcgagaatcaaatatgcccatgagaacgacatcactcacttctatatgctcacc
atagacaaggaccggatcatcgatgcgggccccaaaggaaactattcccgctttatgaac
catagctgccagcccaactgtgagacccttaaatggacagtgaacggtgacactcgtgtg
ggcctgtttgctgtgtgtgacattcctgcagggacggagctgacctttaactacaacctg
gactgtctggggaacgagaagacggtctgtcggtgtggtgcctccaactgcagcgggttc
ctcggggaccgaccaaagacctcagcatccctgtcttcagatgaaaagggcaagaagacc
aagaagagaacccgcaggcggagaaccaggggtgaaggaaagaaggagtctgaggatgag
tgtttccgctgtggggacggcggccagctggtgctgtgtgaccgcaagtcctgcaccaag
gcctaccatctgtcgtgcctgggcctgggcaagcggccctttgggaagtgggaatgtcct
tggcatcactgtgacgtgtgtggcaaaccttccacttcattttgccacttttgccctaat
tcattttgcaaggaacaccaggatgggacagccttcagctccacccaggatgggcggtcg
tactgctacgagcatgacttgggggcagagtcggctcgaagcaccaagactgagaaaccc
ttcccggaacccatgaagtccaaggggaagaggaagaaaaggaggtgctggaggagagtc
acggaaggcaaatag

DBGET integrated database retrieval system