KEGG   Canis familiaris (dog): 479234Help
Entry
479234            CDS       T01007                                 

Gene name
HK1
Definition
(RefSeq) hexokinase-1 isoform X1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00010  Glycolysis / Gluconeogenesis
cfa00051  Fructose and mannose metabolism
cfa00052  Galactose metabolism
cfa00500  Starch and sucrose metabolism
cfa00520  Amino sugar and nucleotide sugar metabolism
cfa00524  Neomycin, kanamycin and gentamicin biosynthesis
cfa01100  Metabolic pathways
cfa01200  Carbon metabolism
cfa04066  HIF-1 signaling pathway
cfa04910  Insulin signaling pathway
cfa04930  Type II diabetes mellitus
cfa04973  Carbohydrate digestion and absorption
cfa05230  Central carbon metabolism in cancer
Module
cfa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cfa_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    479234 (HK1)
   00051 Fructose and mannose metabolism
    479234 (HK1)
   00052 Galactose metabolism
    479234 (HK1)
   00500 Starch and sucrose metabolism
    479234 (HK1)
   00520 Amino sugar and nucleotide sugar metabolism
    479234 (HK1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    479234 (HK1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    479234 (HK1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    479234 (HK1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    479234 (HK1)
 09160 Human Diseases
  09161 Cancers: Overview
   05230 Central carbon metabolism in cancer
    479234 (HK1)
  09167 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    479234 (HK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cfa04131]
    479234 (HK1)
Enzymes [BR:cfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     479234 (HK1)
Membrane trafficking [BR:cfa04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    479234 (HK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 479234
NCBI-ProteinID: XP_005619024
Ensembl: ENSCAFG00000013917
VGNC: 41698
LinkDB All DBs
Position
4
AA seq 935 aa AA seqDB search
MCPPGQINSYIVDADGRGDVEDKSSWCWAGQIMACPSEEIDKYLYAMRLSDETLIDIMTR
FKKEMKNGLSRDFNPTATVKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEQN
QNVHMESEIYDTPENIVHGSGSQLFDHVAECLGDFMEKKKIKDKKLPVGFTFSFPCRQSK
IDEGILITWTKKFKASGVEGMDVVKLLNKAIKKRGDYDANIVAVVNDTVGTMMTCGYDDQ
QCEVGLIIGTGTNACYMEELRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDREID
RGSLNPGKQLFEKMVSGMYLGELVRLILVKMAKESLLFEGRITPELLTRGKLKTSDVSAI
EKNKEGLHNAKEILTRLGVEPSDDDCISVQHVCTIVSFRSANLVAATLGAILNRLRDNKG
TPRLRTTVGVDGSLYKTHPQYARRFHKTLRRLVPDSDVRFLLSESGSGKGAAMVTAVAYR
LAEQHRQIEETLAHFRLTKDMLLEVKKRMRTEMDMGLRKQTHEKAVVKMLPSFVRSTPDG
TEHGDFLALDLGGTNFRVLLVKIRSGKKRTVEMHNKIYAIPIEIMQGTGEELFDHIVSCI
SDFLDYMGIKGPKMPLGFTFSFPCKQTSLDAGILITWTKGFKATDCVGNDVATLLREAIK
RREEFDLDVVAVVNDTVGTMMTCAYEEPTCEVGLIVGTGSNACYMEEMKNVEMLEGNDGR
MCINMEWGAFGDNGCLDDIRTIYDRLVDEYSLNAGKQRFEKMISGMYLGEIVRNILIDFT
KKGFLFRGQISETLKTRGIFQTKYLSQIESDRLALLQVRAILQQLGLNSTCDDSILVKTV
CGVVSKRAAQLCGAGMAAVVDKIRENRGLDHLNVTVGVDGTLYKLHPHFSRIMYQTVKEL
SPKCNVSFLLSEDGSGKGAALITAVGVRLREETSS
NT seq 2808 nt NT seq  +upstreamnt  +downstreamnt
atgtgtccaccagggcaaattaattcctacatagtggacgctgacggccgaggggatgtt
gaggacaagagcagctggtgttgggcggggcagatcatggcatgcccctcggaggagatt
gacaagtatctctatgccatgcggctctccgatgaaactctgatagacatcatgactcgt
ttcaagaaggagatgaagaatggcctctcccgagattttaatccaacagccacagtcaag
atgttgccaacatttgtaaggtccattcctgatggttcagaaaagggagatttcattgcc
ctggatcttggcgggtcttcttttcgaattctgagggtgcaagtgaatcatgagcaaaac
cagaatgttcacatggagtccgagatttacgacaccccggagaatatcgtgcacggcagt
ggaagccagctttttgatcatgtcgccgagtgcctgggggacttcatggagaaaaaaaaa
atcaaggacaagaaattaccagtgggattcacattttctttcccttgtcggcagtccaag
atagacgagggcatcctgatcacctggacaaagaaatttaaagcaagtggagtggagggg
atggatgtggtgaagctgcttaacaaagccatcaagaagcgcggggactacgacgccaac
atagtggctgtggtgaatgacacagtggggaccatgatgacctgtggctatgatgaccag
cagtgtgaggtcggcctcatcattggcactggcactaatgcatgctacatggaggaactg
aggcacattgacctggtggaaggcgatgaggggaggatgtgtatcaacacggagtggggg
gccttcggggacgacgggtccctggaagacatccgcaccgagttcgaccgggagatagac
cggggctctctcaaccctgggaagcagctgtttgagaagatggtcagtggcatgtaccta
ggggagctggttcgactgatactggtcaagatggccaaggagagcctgttatttgaaggg
cggatcacaccggagctgctcaccaggggaaagttgaagaccagtgatgtgtcagccatt
gagaagaataaggaaggcctccacaatgccaaagaaatcctgacccgcctgggagtggag
ccatctgatgatgactgtatttcagtccagcacgtgtgtaccattgtctcatttcgctcc
gcgaacctggtggctgcaacgctgggcgccatcttgaaccgccttcgagataacaagggc
acacccaggctgcggaccacggttggtgtcgacgggtctctttacaagacgcacccacag
tatgcccggcgtttccacaagactctcaggcgcttggtccccgactccgacgtgcgcttc
ctcctctctgagagcggcagcggcaagggggccgccatggtcactgcggtggcctaccgc
ctggccgagcagcaccggcagatagaggagaccctggcccacttccgcctcaccaaggat
atgctgctggaggtgaagaagagaatgcggaccgagatggatatgggcctgaggaagcag
acgcacgaaaaggccgtggtgaagatgctgccctcctttgtccggagcactccagacggg
accgagcatggtgacttcttggcccttgatcttggaggaacaaatttccgtgtcctactg
gtgaaaatccgcagtgggaaaaagagaacggtggaaatgcacaacaagatctatgccatt
cccattgaaatcatgcagggcactggggaagagctgtttgaccacatcgtctcctgcatc
tctgacttcctggactacatggggatcaaaggacccaaaatgcctctgggttttacgttc
tcattcccctgcaagcagacgagcttggacgcgggaatcttgatcacctggacgaagggt
tttaaggcgactgactgcgtggggaacgatgtagcaacgttactaagggaagcgataaaa
aggagagaggaatttgacctggatgtggtggctgtggtcaatgacacggtgggcaccatg
atgacctgtgcttatgaggagcctacatgcgaggttgggctcatcgtagggactggcagc
aatgcttgctacatggaagaaatgaagaatgtcgagatgctggaggggaatgatgggcgg
atgtgtatcaacatggagtggggtgcctttggggacaacgggtgtctagatgatatcaga
acaatctacgacagactggtggatgaatattctctaaacgctgggaaacaaaggttcgag
aagatgattagtggtatgtacctgggggagattgtccgtaacatcttgattgacttcacc
aagaaggggttcctcttccgcgggcagatctctgagacactgaagactcggggcatcttt
cagaccaaatatctttcccagattgagagtgaccgattagcgctgctccaggtccgggcc
atcctccagcagctgggcctgaacagcacctgtgacgacagtatcctcgtcaagaccgtg
tgcggggtggtgtccaagcgggccgcgcagctgtgtggtgcgggcatggctgccgtggtg
gacaagatccgcgagaacagagggctggaccacctcaacgtgactgtgggcgtggatggc
acactctacaagcttcatccgcacttctccagaatcatgtaccaaaccgtgaaggaactg
tcaccaaaatgtaacgtgtccttcctcctgtccgaagacggcagcggcaagggggctgcc
ctcatcacggcggtgggcgtccggctccgggaagagacgagcagctaa

DBGET integrated database retrieval system