KEGG   Canis familiaris (dog): 479856Help
Entry
479856            CDS       T01007                                 

Gene name
ABAT
Definition
(RefSeq) 4-aminobutyrate aminotransferase, mitochondrial
  KO
K13524  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00250  Alanine, aspartate and glutamate metabolism
cfa00280  Valine, leucine and isoleucine degradation
cfa00410  beta-Alanine metabolism
cfa00640  Propanoate metabolism
cfa00650  Butanoate metabolism
cfa01100  Metabolic pathways
cfa04727  GABAergic synapse
Module
cfa_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    479856 (ABAT)
   00650 Butanoate metabolism
    479856 (ABAT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    479856 (ABAT)
   00280 Valine, leucine and isoleucine degradation
    479856 (ABAT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    479856 (ABAT)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    479856 (ABAT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cfa01007]
    479856 (ABAT)
Enzymes [BR:cfa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     479856 (ABAT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     479856 (ABAT)
Amino acid related enzymes [BR:cfa01007]
 Aminotransferase (transaminase)
  Class III
   479856 (ABAT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3 Lenti_VIF_2 Tex_N
Motif
Other DBs
NCBI-GeneID: 479856
NCBI-ProteinID: XP_005621619
Ensembl: ENSCAFG00000019030
VGNC: 37421
UniProt: E2R776
LinkDB All DBs
Position
6
AA seq 500 aa AA seqDB search
MAFMLLRRRLPCTFQHNYHLLAPSSRHISQAAAKVDVEFDYDGPLMKTEVPGPKSRELMK
QLNIIQNAEAVHFFCNYEESRGNYLVDVDGNRMLDLYSQISSVPIGYSHPALLKLVQQPQ
NASTFINRPALGILPPENFVEKLRESLLSVAPKGMSQLITMSCGSCSNENAFKTIFIWYR
NKERGQTGFSKEELETCMINQAPGCPEYSILSFMGAFHGRTMGCLATTHSKAIHKIDIPS
FDWPIAPFPRLKYPLEEFVKENQQEEARCLEEVEDLIVKYRKKKKTVAGIIVEPIQSEGG
DNHASDDFFRKLRDISRKHGCAFLVDEVQTGGGCTGKFWAHEHWGLADPADVMTFSKKMM
TGGFFHKEEFRPNAPYRIFNTWLGDPSKNLLLAEVINIIKREDLLNNAAHAGKALLTGLL
DLQARYPQFISRVRGRGTFCSFDTPDETIRNKLILMARNKGVVLGGCGDKSIRFRPTLVF
RDHHAHLFLNIFSDILADFK
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggccttcatgttgctccgccggcggctgccctgcaccttccagcacaactaccacctg
cttgcccccagctccagacacatcagtcaggccgcagccaaagttgatgttgaatttgac
tatgacgggcccctgatgaagacagaagtcccagggcctaaatctcgggagttaatgaaa
cagctgaatataattcagaacgcagaggctgtgcactttttctgcaattatgaagagagc
cgaggcaattacctggttgacgtggatgggaaccggatgttggacctttactcccagatc
tcctctgtccccataggctacagccaccctgctctcctgaaactggttcaacagcctcaa
aatgcgagcacattcatcaacagacctgccctgggcatccttcctcctgagaacttcgtg
gagaagctgcgggagtccttgctctcggtggctcccaaagggatgtcccagctcatcacc
atgtcctgcggctcctgctccaatgaaaatgcctttaagacgatcttcatatggtaccgg
aacaaggaaaggggtcaaacaggtttctccaaagaggagctggagacgtgcatgatcaac
caggcccccggctgccccgagtacagcatcctctccttcatgggcgcgttccacgggagg
accatgggatgcttagcgaccacacactccaaagctattcataagatcgacatcccttcc
ttcgactggcccatcgctccgttcccacggctgaaataccctctggaagagtttgtgaaa
gagaaccagcaagaagaagcccgctgcctggaagaggtggaggatctgatcgtgaaatat
cggaaaaagaagaagacggtggccgggatcatcgtggagcccatccagtctgagggcgga
gacaaccacgcgtccgacgacttcttccggaagctgagagacatctccaggaagcacggc
tgtgccttcttggtggatgaggtccagacaggaggcggctgcaccggcaagttctgggcc
catgagcactggggcttggctgacccggcggatgtgatgaccttcagcaagaagatgatg
accgggggcttcttccacaaggaggagttcaggcccaacgccccctaccggatctttaac
acctggctgggggacccgtctaagaacctgctgctggccgaggtcatcaacatcatcaag
cgggaggacctgctgaataacgcagcccatgccgggaaggccctgctgacggggctgctg
gacctgcaggcccggtacccccagttcatcagcagagtgagaggacgaggcaccttctgc
tccttcgacacgcccgatgaaaccattcggaataaactcattctaatggccagaaacaaa
ggcgtggtgttgggaggctgcggggacaaatccattcgattccgccccactctggtcttc
agggatcaccacgcacacctgttcctcaatattttcagcgacatcttagcagacttcaag
taa

DBGET integrated database retrieval system