KEGG   Canis familiaris (dog): 480516Help
Entry
480516            CDS       T01007                                 

Gene name
EZH1
Definition
(RefSeq) histone-lysine N-methyltransferase EZH1
  KO
K17451  histone-lysine N-methyltransferase EZH1 [EC:2.1.1.43]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    480516 (EZH1)
Enzymes [BR:cfa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     480516 (EZH1)
Chromosome and associated proteins [BR:cfa03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     480516 (EZH1)
   Polycomb group proteins
    PRC2-EZH1 complex
     480516 (EZH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PRC2_HTH_1 SET EZH2_WD-Binding preSET_CXC
Motif
Other DBs
NCBI-GeneID: 480516
NCBI-ProteinID: XP_022278681
Ensembl: ENSCAFG00000014827
VGNC: 40540
LinkDB All DBs
Position
9
AA seq 759 aa AA seqDB search
MDMPNPPTSKCITYWKRKVKSEYMRLRQLKRLQANMGAKALYVANFAKVQEKTQILNEEW
KKLRVQPVQLMRPASGHPFLKKCTIESIFPGFASQHMLMRSLNTVALVPIMYSWSPLQQN
FMVEDETVLCNIPYMGDEVKEEDETFIEELINNYDGKVHGEEEMIPGSVLISDAVFLELV
DALNQYSDDEEEGHNDTSDGKQDDNKEDLPVTRKRKRHALEGNKKSSKKQFPNDMIFSAI
ASMFPENGVPDDMKERYRELTEMSDPNALPPQCTPNIDGPNAKSVQREQSLHSFHTLFCR
RCFKYDCFLHREWGYSKILSCSPFPNTTSFYTQRDAEIQIEPEPCGTDCFLLLEGAKEYA
MLHNPRSKCSGRRRRRHHMVSASCSNTSASTVAETKEGDSDRDTGNDWASSSSEANSRCQ
TPTKQKASPAPPQLCVVEAPSEPVEWTGAEESLFRVFHGTYFNNFCSIARLLGTKTCKQV
FQFAVKESLILKLPTDELMNPSQKKKRKHRLWAAHCRKIQLKKDNSSTQVYNYQPCDHPD
RPCDSTCPCIMTQNFCEKFCQCNPDCQNRFPGCRCKTQCNTKQCPCYLAVRECDPDLCLT
CGASEHWDCKVVSCKNCSIQRGLKKHLLLAPSDVAGWGTFIKESVQKNEFISEYCGELIS
QDEADRRGKVYDKYMSSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVVMVNGDHR
IGIFAKRAIQAGEELFFDYRYSQADALKYVGIERETDVL
NT seq 2280 nt NT seq  +upstreamnt  +downstreamnt
atggatatgccaaatcccccaacttccaaatgtattacttactggaaaagaaaagtcaaa
tctgaatacatgcgactccggcaactgaaacggcttcaggcaaatatgggcgccaaggct
ctctatgtggcaaattttgcaaaggttcaagaaaaaacccagatcctcaatgaagagtgg
aagaagcttcgtgttcaacctgtacagttgatgaggcctgcaagtgggcatccttttctc
aaaaagtgtaccatagagagcattttcccaggatttgcaagccaacatatgttaatgaga
tctctgaacacagttgcattggttcccatcatgtattcctggtcccctctccagcagaac
tttatggtagaagatgagacagttttgtgcaatattccctacatgggagatgaggtgaaa
gaagaagatgagactttcattgaggagctgatcaataactatgatgggaaagtccacggc
gaagaagagatgatccctggatctgtcctgattagtgatgcagtattcctggagttggta
gatgctctgaatcaatactcagatgatgaggaggaagggcacaatgacacctcagatgga
aagcaagatgacaacaaagaagatctgccagtaacaagaaagagaaaaagacatgctctt
gaaggcaacaaaaagagttccaaaaaacagttcccaaatgacatgatcttcagtgcaatt
gcctcaatgttccctgagaatggagtcccagacgacatgaaggagaggtaccgagagctc
acagagatgtcagaccccaatgcactcccccctcagtgcacacccaacattgatggcccc
aatgccaagtctgtgcagcgggagcagtctctgcactccttccatacactgttttgtcga
cgctgcttcaaatatgactgcttccttcaccgtgagtggggctattccaaaatactctcc
tgttctccattcccaaacaccacttccttctacacacagagagacgcagagatccagatt
gaaccagaaccatgtggcacagactgcttccttttgctggaaggagcaaaggagtatgcc
atgctccacaaccctcgctccaagtgctctggtcgtcgccggcgaaggcaccacatggtc
agtgcttcctgctccaacacttcagcctctactgtggctgagactaaagaaggggacagt
gacagggatacaggcaatgactgggcctccagttcttcagaggccaactctcgctgtcag
actcccacaaagcagaaagctagtccggctccacctcagctctgtgtagtggaagcaccc
tcggagcctgtggagtggactggggctgaggagtccctttttcgagtctttcatggcacc
tacttcaacaacttctgttccatagccagacttctgggcactaagacgtgcaagcaggtc
tttcagtttgctgtcaaagaatcacttatcctgaagctgccaacagatgagctcatgaac
ccatcacagaagaagaaaagaaagcacaggctgtgggctgcacactgtaggaaaattcag
ctgaagaaggataattcttccacgcaagtatacaattaccagccctgcgaccatccagac
cgcccctgtgacagcacctgcccctgcatcatgacgcagaatttctgtgagaagttctgc
cagtgcaaccctgactgtcagaatcgttttcctggctgtcgctgtaagacccagtgcaac
accaagcaatgtccctgctacttggcagtgcgagagtgtgaccccgacctgtgcctcaca
tgtggggcctcagagcactgggactgcaaggtggtttcctgcaaaaactgcagcatccag
cgaggcctcaagaagcacctgctgctggccccctcagatgtggccggatggggcaccttc
attaaggagtctgtgcaaaaaaacgaattcatttctgaatactgtggtgagcttatttct
caggatgaggctgatcgacgggggaaggtctatgacaaatacatgtccagcttcctcttc
aacctcaacaatgattttgtagtagatgctaccagaaaaggaaacaagattcgatttgca
aaccattcagtgaaccccaactgttatgccaaagtggtcatggtaaatggggatcatcgc
atcgggatctttgctaaaagggcaattcaagctggtgaagagctcttctttgattacagg
tacagccaagccgatgccctcaagtacgtgggaatcgagagggagaccgatgtcctttag

DBGET integrated database retrieval system