KEGG   Canis familiaris (dog): 480825Help
Entry
480825            CDS       T01007                                 

Definition
(RefSeq) pancreatic alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00500  Starch and sucrose metabolism
cfa01100  Metabolic pathways
cfa04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    480825
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    480825
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     480825
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase_C Alpha-amylase
Motif
Other DBs
NCBI-GeneID: 480825
NCBI-ProteinID: XP_537942
Ensembl: ENSCAFG00000031239
UniProt: J9PAL7
LinkDB All DBs
Position
Unknown
AA seq 511 aa AA seqDB search
MKFFLLLSVIGFCWAQYAPNTKPGRTSIVHLFEWRWADIALECERYLAPRGFGGVQISPP
NENVVINNPSRPWWERYQPISYKLCTRSGNEDEFKDMVTRCNNVGVYIYVDAVINHMCGN
AVSAGTSSTCGSYFNPGNRDFPAVPFSGWDFNDGKCKTGSGDIENYNDPYQVRDCRLVGL
LDLALEKDYVRSKIAEYLNHLIDIGVAGFRIDASKHMWPGDMKAVLDKLHNLNTRWFPGG
SKPFIYQEVIDLGGEPIKSQEYFGNGRVTEFKYGAKLGTVLRKWNGEKMAYLKNWGEGWG
FMPSDRALVFVDNHDNQRGHGAGGASILTFWDSRLYKMGVGFMLAHPYGFTRVMSSFRWP
RYFENGKDVNDWYGPPNNNGIIKEVTINPDTTCGNDWVCEHRWRQIRNMVMFRNVVDGQP
FTNWWDNGSNQVAFGRGNKGFIVFNNDDWPLSLTLQTGLPAGTYCDVISGDKIDGNCTGI
KIYISGDGNAHFSISNSAEDPFIAIHAESKL
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgaagttctttctattgctttcagtcattgggttctgctgggctcagtatgccccaaat
accaaacctggacggacatctattgtccatctgtttgagtggcgctgggctgacattgct
cttgaatgcgaacgatacttagctccaagaggatttggaggggttcagatttctccaccc
aatgaaaatgttgtgattaataacccttcaagaccttggtgggaaagataccaaccaatt
agctacaagttgtgcacaagatcaggaaatgaagatgaattcaaagacatggtgactcgg
tgtaacaatgttggtgtctatatttatgtggatgctgtaattaatcatatgtgtgggaat
gctgtgagtgcaggaacaagcagtacttgtggaagttacttcaaccctggaaacagagat
tttccagcggtcccattctctggttgggattttaatgatggtaaatgtaaaactggaagt
ggagacattgaaaactataatgatccgtatcaggtcagagattgtcgtctggttggtctt
cttgatcttgcactggagaaagattatgtgcgttccaagattgctgaatatctaaaccac
ctcattgacattggtgtagcagggttcagaattgatgcttccaagcacatgtggcctgga
gacatgaaggcggttttggataaactgcataatctaaatacaaggtggttccctggagga
agtaaacctttcatttaccaggaggtaattgatctgggtggtgagccaattaaaagccaa
gagtactttggaaatggccgtgtgacggaattcaagtatggtgcaaaactaggcacagtt
ctgcgcaaatggaatggagaaaagatggcttacttaaagaactggggagaaggatggggt
ttcatgccttctgatagagcacttgtctttgtggataaccacgacaatcaacgaggacat
ggagctggaggagcatctattcttacgttctgggactctagactgtacaaaatgggagtt
ggatttatgcttgctcatccatatggatttacacgagtaatgtcaagcttccgttggcca
agatactttgaaaatggaaaagatgttaatgattggtatgggccaccaaataataatggg
ataattaaagaagttactattaatccagatactacttgtggtaatgattgggtctgtgaa
catcgatggcgtcaaataagaaacatggttatgttccgtaatgtagttgatggacaacct
tttacaaactggtgggataatggtagcaaccaagtagcttttggaagaggaaacaaaggg
ttcattgtctttaacaatgatgactggccattatctttaactctgcaaactggtcttcct
gctggcacatattgtgatgttatttctggagataaaattgacggcaattgtacaggaatt
aaaatctatatttctggggatgggaatgctcatttttctattagtaactcggctgaagat
ccatttattgcaattcatgctgaatctaaactgtaa

DBGET integrated database retrieval system