KEGG   Canis familiaris (dog): 481184Help
Entry
481184            CDS       T01007                                 

Gene name
CPT1B
Definition
(RefSeq) carnitine O-palmitoyltransferase 1, muscle isoform isoform X3
  KO
K19523  carnitine O-palmitoyltransferase 1, muscle isoform [EC:2.3.1.21]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00071  Fatty acid degradation
cfa01212  Fatty acid metabolism
cfa03320  PPAR signaling pathway
cfa04152  AMPK signaling pathway
cfa04714  Thermogenesis
cfa04920  Adipocytokine signaling pathway
cfa04922  Glucagon signaling pathway
cfa04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    481184 (CPT1B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    481184 (CPT1B)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    481184 (CPT1B)
   04920 Adipocytokine signaling pathway
    481184 (CPT1B)
   03320 PPAR signaling pathway
    481184 (CPT1B)
  09159 Environmental adaptation
   04714 Thermogenesis
    481184 (CPT1B)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    481184 (CPT1B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:cfa03029]
    481184 (CPT1B)
Enzymes [BR:cfa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     481184 (CPT1B)
Mitochondrial biogenesis [BR:cfa03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    481184 (CPT1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf CPT_N
Motif
Other DBs
NCBI-GeneID: 481184
NCBI-ProteinID: XP_005625759
Ensembl: ENSCAFG00000000586
VGNC: 39580
LinkDB All DBs
Position
10
AA seq 818 aa AA seqDB search
MAEAHQAVAFQFTVTPDGVDFRLSREALKHIYLSGINSWKKRLIRIKNGILRGVYPGSPT
SWLVIVMATVGSSYCKVDISMGLVCCIQRCLPEGCGPYRTPQTRALLSMAIFSTGVWMMG
IFFFRQTLKLLLSYHGWMFEMHGQTSHFTKVWAICVRLLSSRRPMLYSFQTSLPKLPVPS
VPATVQRYLESVRPLLDDEEYYRMEVLAKEFQDKTAPRLQKYLVLKSWWATNYVSDWWEE
YVYLRSRAPLVVNSNYYVMDFVLIKNTNIQAARLGNVVHAMIMYRRKLDREEIKPVMALG
IVPMCSYQMERMFNTTRIPGKETGTGPQPGVRARARAVLGPSGPSPPTLPARGLHARCPP
ICSSSPNVPDLLQHLSDSRHVAVYHKGRFFKLWLYEGSQLLKPCDLELQFQRILDDPSPP
QPGEEKLAALTAGGRLEWAQARQAFFSSGKNKAALDAIERAAFFVALDEESHHYDPEDEA
SLSLYGKALLHGNCYNRWFDKSFTVIAFKNGQLGLNTEHAWADAPIIGHLWEFVLGTETF
HLGYTETGHCQGKANPALAAPQRLQWDIPEQCRAVIESSCQVATALADDVELYCFQFLPF
GKGLIKKCRTSPDAFVQIALQLAHFRDRGKFCLTYEASMTRMFREGRTETVRSCTSESTA
FVQAMAEGSRMKADLRDLFRKASKKHQNMYRLAMTGAGIDRHLFCLYVVSKYLGVSSPFL
AEVLSEPWRLSTSQIAQFQIRMFDPDKYPKHLGAGGGFGPVADDGYGVSYMIAGENTIFF
HISSKFSSSETNAQRFGNHIRQALLDIADLFQGPKADS
NT seq 2457 nt NT seq  +upstreamnt  +downstreamnt
atggcggaagcgcaccaggccgtggccttccagttcaccgtgaccccagacggggtggac
ttccggctcagtcgggaggccctgaagcacatctacctgtccgggatcaactcctggaag
aaacgcctgattcgcatcaagaatggcatcctcaggggcgtgtaccctggcagccccacc
agctggctggtcattgtcatggcgacggtgggctcttcctactgcaaggtggacatctcc
atggggctggtgtgctgcatccagagatgcctccctgagggatgtggcccctaccggacc
ccacagacccgggcacttctcagcatggccattttctccactggggtctggatgatgggc
atcttcttcttccgccaaaccctgaaactgcttctttcctaccacggttggatgttcgag
atgcacggccagaccagccacttcaccaaagtctgggctatctgtgtccgcctgctgtcc
agccggaggcccatgctctacagcttccagacatccctgcccaagcttcctgtgcccagc
gtgccggccacagttcagcggtacttggagtctgtgcggcccttgctggatgatgaggaa
tactaccgaatggaggtcctggccaaggaattccaggacaagaccgccccccggctgcag
aagtacctggtcctcaagtcatggtgggcaaccaactatgtgagtgactggtgggaagag
tatgtgtacctgcgcagcagggcgcctctcgtggtgaacagcaactactatgtcatggac
ttcgtgctcatcaagaatacaaacatccaggcagcccgcctgggcaacgtcgtgcacgct
atgatcatgtaccgccgtaaactggaccgcgaggagatcaagcctgtgatggccctgggc
attgtgcccatgtgttcctaccagatggagaggatgttcaacacgacccggatcccgggc
aaggagacaggtactgggccacagccaggtgtccgtgctcgtgctcgtgctgtgctgggg
ccgtcaggaccgagtccccccaccctcccagctcggggcctgcatgctaggtgccctcca
atctgctcgtcatcaccaaatgtcccagacctgctgcagcacctgtcggacagcaggcac
gtggctgtctaccacaagggccgcttcttcaagctgtggctgtatgagggctcccagctg
ctcaagccctgcgacctggagctgcagttccagaggatcctggacgacccgtccccgccc
cagcccggggaggagaagctagcagcgctcacggccgggggaagactggagtgggcacag
gcgcgccaggccttcttcagctccggcaagaacaaggctgctctggatgccatcgagcga
gctgccttctttgtggccctggacgaggagtctcaccactacgaccccgaggatgaggcc
agcctcagcctgtacggcaaggccctgctgcacggcaactgctacaacaggtggttcgac
aagtctttcacggtcatcgccttcaagaacggccagctgggcctcaacacagaacacgcg
tgggcagacgcccccatcatagggcacctctgggagtttgtcctgggtactgagaccttt
cacctcggctacacggagactgggcactgccagggcaaagctaaccccgcgctggccgct
ccccagcggctgcagtgggacatccctgagcagtgccgagcggtcatcgagagctcctgc
caggtggccacggcactagccgacgacgtggagctgtactgcttccagttcctgccgttc
ggcaaaggcctcatcaagaagtgtcgcactagcccggacgccttcgtgcagattgccctg
caactcgcccacttccgggacaggggcaagttctgtctcacctacgaggcctccatgacc
aggatgttccgggagggacggaccgagaccgtgcgctcctgcaccagcgagtccacagcc
ttcgtgcaggccatggcagaggggtcccgcatgaaagctgacctccgagacctcttccgg
aaggcttccaagaaacaccagaatatgtaccgcctggcgatgacaggggctggcatagac
aggcacctcttctgcctctacgtggtctccaagtacctgggggtcagctcccctttcctg
gctgaggtgctctcggagccctggcgcctctccaccagccagattgctcaattccagatc
cgcatgttcgacccagacaagtaccccaaacacctgggcgccggtggtggctttggccct
gtggcagacgatggctacggggtttcctacatgatcgcgggcgagaacaccatcttcttc
cacatctccagcaagttctcaagctcagagacgaacgcccagcgctttggaaaccacatc
cgccaagctctgctggacatcgctgatcttttccaaggtcccaaggctgacagctga

DBGET integrated database retrieval system