KEGG   Canis lupus familiaris (dog): 481497
Entry
481497            CDS       T01007                                 

Gene name
IL3
Definition
(RefSeq) interleukin-3 precursor
  KO
K04736  interleukin 3
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa04060  Cytokine-cytokine receptor interaction
cfa04151  PI3K-Akt signaling pathway
cfa04210  Apoptosis
cfa04630  JAK-STAT signaling pathway
cfa04640  Hematopoietic cell lineage
cfa04664  Fc epsilon RI signaling pathway
cfa05200  Pathways in cancer
cfa05202  Transcriptional misregulation in cancer
cfa05221  Acute myeloid leukemia
cfa05310  Asthma
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    481497 (IL3)
   04151 PI3K-Akt signaling pathway
    481497 (IL3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    481497 (IL3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    481497 (IL3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    481497 (IL3)
   04664 Fc epsilon RI signaling pathway
    481497 (IL3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    481497 (IL3)
   05202 Transcriptional misregulation in cancer
    481497 (IL3)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    481497 (IL3)
  09163 Immune disease
   05310 Asthma
    481497 (IL3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cfa04052]
    481497 (IL3)
   00536 Glycosaminoglycan binding proteins [BR:cfa00536]
    481497 (IL3)
Cytokines and growth factors [BR:cfa04052]
 Cytokines
  Interleukins
   481497 (IL3)
Glycosaminoglycan binding proteins [BR:cfa00536]
 Heparan sulfate / Haparin
  Cytokines
   481497 (IL3)
SSDB
Motif
Pfam: IL3
Other DBs
NCBI-GeneID: 481497
NCBI-ProteinID: NP_001013857
Ensembl: ENSCAFG00000000817
VGNC: 53502
UniProt: Q9BDX4
LinkDB
Position
11
AA seq 143 aa
MSSFPILHLLLLLLGCQVPQAQGRPFSTDLPKQYFTMINEIMEMLNKSPSPSEEPLDSNE
KETLLEDTLLRPNLDVFLNASSKFHKNGLLIWNNLKEFLPLLPTPTPRGEPISIMENNWG
DFQRKLKKYLEALDNFLNFKNKP
NT seq 432 nt   +upstreamnt  +downstreamnt
atgagcagcttccccatcctgcaccttctcttgctcctgcttggatgccaagtcccacag
gcacaggggaggcctttttcgacagacctgcctaagcaatacttcacaatgatcaatgaa
attatggagatgttaaacaagtcaccctcgccttcagaagaacccttggactcaaatgag
aaagagaccttgctggaagatacccttctgaggccaaacctggatgtattcttgaatgct
tccagcaaattccacaaaaatggattgctaatctggaataatcttaaggaattcctgcca
ctcctgcccactcccacacccaggggagaaccaatctctatcatggagaataattggggt
gatttccaaaggaaattgaaaaaatatctggaagcccttgataactttctgaatttcaag
aacaaaccctga

DBGET integrated database retrieval system