KEGG   Canis familiaris (dog): 481526Help
Entry
481526            CDS       T01007                                 

Gene name
CDC23
Definition
(RefSeq) cell division cycle protein 23 homolog isoform X2
  KO
K03355  anaphase-promoting complex subunit 8
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04110  Cell cycle
cfa04114  Oocyte meiosis
cfa04120  Ubiquitin mediated proteolysis
cfa04914  Progesterone-mediated oocyte maturation
cfa05166  HTLV-I infection
Module
cfa_M00389  APC/C complex
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    481526 (CDC23)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    481526 (CDC23)
   04114 Oocyte meiosis
    481526 (CDC23)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    481526 (CDC23)
 09160 Human Diseases
  09167 Infectious diseases
   05166 HTLV-I infection
    481526 (CDC23)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:cfa04121]
    481526 (CDC23)
   03036 Chromosome and associated proteins [BR:cfa03036]
    481526 (CDC23)
Ubiquitin system [BR:cfa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     481526 (CDC23)
Chromosome and associated proteins [BR:cfa03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    481526 (CDC23)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANAPC8 TPR_1 TPR_2 TPR_8 TPR_14 TPR_19 TPR_11 TPR_7 ANAPC3 TPR_16 TPR_17 TPR_12 TPR_9 DUF772 TPR_15
Motif
Other DBs
NCBI-GeneID: 481526
NCBI-ProteinID: XP_022281061
Ensembl: ENSCAFG00000001209
VGNC: 51703
LinkDB All DBs
Position
11
AA seq 571 aa AA seqDB search
MAASPSVVPVAVTAAVVPVLSSSSDFSNLREIKKQLLLIAGLTRERGLLHSSKWSAELAF
SLPALPLAELQPPPPITEEDAQDMDAYTLAKAYFDVKEYDRAAHFLHGCNSKKAYFLYMY
SRYLSGEKKKDDETVDSLGPLEKGQVKNEALRELRVELSKKHQARELDGFGLYLYGVVLR
KLDLVKEAIDVFVEATHVLPLHWGAWLELCNLITDKEMLKFLSLPDTWMKEFFLAHIYTE
LQLIEEALQKYQNLIDVGFSKSSYIVSQIAVAYHNIRDIDKALSIFNELRKQDPYRIENM
DTFSNLLYVRSMKSELSYLAHNLCEIDKYRVETCCVIGNYYSLRSQHEKAALYFQRALKL
NPRYLGAWTLMGHEYMEMKNTSAAIQAYRHAIEVNKRDYRAWYGLGQTYEILKMPFYCLY
YYRRAHQLRPNDSRMLVALGECYEKLNQLVEAKKCYWRAYAVGDVEKMALVKLAKLHEQL
TESEQAAQCYIKYIQDIYSCGEIVEHLEESTAFRYLAQYYFKCKLWDEASTCAQKCCAFN
DSPDFISDPGRREGLAPANPTTSEPRRDSIY
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgagtccgtctgtagtcccggtggctgtgactgctgcggtggtgccggtcttg
tcatcgagcagcgatttctcaaatttgcgagaaattaagaagcagctgctactcatcgca
ggccttacgcgggagcggggcctactgcatagtagcaaatggtccgcggagttggccttt
tccctccccgccttgcctctggcggagctgcagccaccgccgcctattacagaggaggat
gcccaggatatggatgcttacaccctggccaaagcctactttgatgttaaagaatatgat
cgagcagcacatttcctgcatggctgcaatagcaagaaagcctatttcctatacatgtat
tccagatatctgtctggagaaaagaagaaggatgatgaaacagttgatagcctaggtccc
ctggagaaaggacaagtaaaaaatgaggcacttagagaactgagagtggagctcagcaaa
aaacaccaggctcgggaacttgatggatttggcctttatctatatggtgtggtgcttcga
aaactggacctggtgaaagaggccattgatgtgtttgtggaggctactcatgttttgcct
ttgcattggggagcctggctagaactctgtaacttgattacagacaaagagatgctgaag
ttcctgtctttgccagacacctggatgaaagagttttttctggctcatatatacacagag
ttgcagttgatagaggaggctctgcaaaagtatcagaatctcattgatgtgggcttctct
aagagctcatatattgtttcccaaattgcagttgcctatcacaatatcagagatattgac
aaagccctttctatttttaatgagctgaggaaacaagatccttacaggattgaaaatatg
gacacattctccaaccttctatatgtcaggagcatgaaatctgagttgagttatctggct
cacaacctctgtgagatagataagtatcgtgtagagacatgctgtgtaattgggaattat
tatagtttacgttctcaacatgaaaaagcagccttatatttccagagagccctgaaattg
aatcctcggtatcttggggcctggacactgatgggacatgaatacatggaaatgaagaac
acatctgctgctattcaggcttatcgacatgccattgaggtcaataaacgagactacaga
gcctggtatgggcttggacagacctatgaaatccttaagatgccgttttattgcctttat
tattatagacgggcacatcagcttcggcccaatgattctcgtatgctggttgctttagga
gaatgttatgagaaactcaatcaactagtggaagccaaaaagtgttattggagagcttac
gccgtgggagatgtggagaaaatggctctggtgaaactggcaaagcttcatgaacagttg
actgagtcagaacaagctgcccagtgttacatcaaatatatccaagatatctattcctgt
ggggagatagtggagcacctggaggagagcactgctttccgctatttggcccagtactat
tttaaatgcaagctgtgggatgaagcttcaacttgtgcccagaaatgttgtgcattcaat
gattcgcctgactttatttcagacccgggaagaagggaaggccttgctccggcaaatcct
acaacttcggaaccaaggcgagactccatctactga

DBGET integrated database retrieval system