KEGG   Canis familiaris (dog): 482506
Entry
482506            CDS       T01007                                 

Gene name
CYP4A37
Definition
(RefSeq) cytochrome P450 4A37
  KO
K07425  long-chain fatty acid omega-monooxygenase [EC:1.14.14.80]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00071  Fatty acid degradation
cfa00590  Arachidonic acid metabolism
cfa00830  Retinol metabolism
cfa01100  Metabolic pathways
cfa03320  PPAR signaling pathway
cfa04270  Vascular smooth muscle contraction
cfa04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    482506 (CYP4A37)
   00590 Arachidonic acid metabolism
    482506 (CYP4A37)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    482506 (CYP4A37)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    482506 (CYP4A37)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    482506 (CYP4A37)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    482506 (CYP4A37)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:cfa00199]
    482506 (CYP4A37)
Enzymes [BR:cfa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.80  long-chain fatty acid omega-monooxygenase
     482506 (CYP4A37)
Cytochrome P450 [BR:cfa00199]
 Cytochrome P450, animal type
  CYP4 family
   482506 (CYP4A37)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 482506
NCBI-ProteinID: NP_001041490
Ensembl: ENSCAFG00000023282
UniProt: Q2VHZ9
LinkDB
Position
15
AA seq 510 aa
MSVSVLSLTRPLDTVSGLLQLASLLGLALLLLKAAQLYQRRQWLLKAVQQFPSPPSHWFF
GHKQEFQTGQELQVFQKWTEKYPCASPRWLWGSRVSLVVYDPDYMKMILGRSDPKAGGSY
TFITPWIGYGLLLLHGEAWFQHRRMLTPAFHYDILKPYVRLMADSVQVMLDKWEELLTQN
SHLEIFEHVSLMTLDTIMKCAFSYQGNHQADRNSQAYIQAIRDMNNLVFARVRNVFYQKD
IFYGLTSEGRRNHKARQIAHQHTDRVIKLRKAQLQDEGELEKVRNKRHLDFLDILLFAKM
ENGKGLSDKDLRAEVDTFMFEGHDTTASGISWILYALATHPEHQQRCREEIQSLLGDGAS
ITWEHLDQMPYTTMCIKEALRLYPPVPGVGRELSKPITFTDGRSLPKGFLVSLSFYALHH
NPNVWPNPEVFDPSRFAPDASRHSHAFLPFSGGSRNCIGQHFAMNELKVAVALTLLRFEL
APDPFKIPVPTPRIVLMSKNGIHLHLRKLL
NT seq 1533 nt   +upstreamnt  +downstreamnt
atgagtgtctctgtactgagcctcaccagacccctggacactgtgtctgggctcctgcag
ctggcctccctgctaggcctggctctgctgctgctcaaggcagcacaactctaccagcgc
aggcagtggctgctgaaagctgtccagcagttcccgtcccctccttcccactggttcttc
gggcacaagcaggagttccaaacgggtcaggagctgcaagtgtttcagaaatggacagag
aaatacccttgtgccagtcctcgttggctatggggaagcagagttagcctcgtagtctat
gacccagactacatgaagatgatcctggggcgatcagacccaaaagctggtggttcctac
acattcatcactccctggatagggtatggtttgctcctgctgcatggagaggcatggttc
cagcaccggaggatgctgaccccagccttccactatgacatcctgaagccttacgtgaga
ctcatggctgactctgtccaagtgatgctggacaagtgggaggaactcctcacccagaac
tcacatctagagatctttgaacacgtctccttgatgaccttggacaccattatgaagtgt
gccttcagctaccagggcaaccaccaggcagacaggaactcccaggcctacattcaggcc
attcgagatatgaacaacctggtgtttgcccgggtgaggaatgttttctaccagaaagac
atcttctacgggctgacctctgaaggccgcaggaaccacaaggcccgccagattgcccat
caacacacagaccgagtgatcaagctgaggaaggcacagctacaggacgagggagagctg
gagaaggtcaggaacaagaggcacttggacttcctggacatcctcctctttgccaaaatg
gagaatgggaagggcttgtctgacaaggacctccgtgcagaagtggacacattcatgttt
gaggggcatgacaccacagcgagtggcatctcctggatcctctatgctctggccacacac
cccgagcatcagcagagatgccgggaggagatccagagccttctgggagatggtgcctcc
atcacctgggagcacctggaccagatgccctacaccaccatgtgcatcaaggaggcattg
cgactctatccaccagttccaggtgttggcagagagctcagcaagcccatcaccttcact
gatggacgctccttgcccaaaggattcttagtctcgctctccttttatgctcttcaccac
aacccgaatgtgtggccaaacccagaggtgttcgacccttcccgctttgcaccagatgcc
tctcgacacagccatgctttcctgcccttctcaggaggatcaaggaactgcattgggcag
cactttgccatgaacgagttgaaggtggcggtggccctgaccctgctccgctttgagctg
gcaccagatcccttcaagatccctgttccaactccaagaattgtattgatgtccaagaat
gggatccacctgcatctcaggaagctcctctaa

DBGET integrated database retrieval system