KEGG   Canis familiaris (dog): 482756Help
Entry
482756            CDS       T01007                                 

Gene name
MGAM2
Definition
(RefSeq) putative maltase-glucoamylase-like protein FLJ16351 isoform X1
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00052  Galactose metabolism
cfa00500  Starch and sucrose metabolism
cfa01100  Metabolic pathways
cfa04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    482756 (MGAM2)
   00500 Starch and sucrose metabolism
    482756 (MGAM2)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    482756 (MGAM2)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     482756 (MGAM2)
    3.2.1.20  alpha-glucosidase
     482756 (MGAM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 482756
NCBI-ProteinID: XP_022259431
Ensembl: ENSCAFG00000025371
LinkDB All DBs
Position
16
AA seq 1575 aa AA seqDB search
MARKLTILEVLLIIFFLTVLALDIFLMFFVLNIEATAFAPECPEIPESERIDCAPGQVVT
EDVCRQQHRCCWKPVSDINVPTCFFPRNWGYKVIDSQNNTRTALEFTAHLKKLSFPSLFG
YDVDEAFFTAEYQTSNRFHFKINDTNNIRYEVQHENINLFNRTNRAINFNYYLEVIHKPF
SIKIIRKSNGRVLLDTSIGPLQFAQQYLQLSFRLPSATVYGLGEHVHQQYRHNMTWKTWP
IFTRDAAPTEGMINLYGAHTFFLCLEDISGFSFGVFLLNSNAMEVTLQPAPAITYRTTGG
ILDFYVFLGNTPEQVIQEYLELIGRPFLPPYWSLGFQLSRRNYGGINGLKEVVNRNRLAQ
IPYDVQYSDIDYMDGNKDFTIDKVAFSNLSNFVNELHNQGMKYVIIMNPGISNNSGYQPY
VNGSTKRVWILGDNGFVLGKGYPGWTVFPDYSNPTCVEWWREQFSAFNKILQFDGVWIEM
DEVSSFLQDSDRKCERNSLNFPPFVPQILDRSLFAGTLCMDAELYWGLHYDVHSLYGYSM
AKATHSAMENIFPGKNNFILSRSTFAGSGKFAGHWLGDNAATWDDLRWSIPSILEFNLFG
IPMVGANICGYTKNVTEDLCTRWMQLGAFYPLSRNHNGPEFRDQDPAAFGEHSLLLKSSR
HYLNIRYTLLPYLYTLFYRAHTRGDTVARPLVHEFYQDPATWDVHEQFLWGPGLLITPVL
YEGVDLVKAYIPDAIWYDYETGVAMQWRKQSVEMQLPLDKIGLHLRGGFIFPTQQPSTTT
EISRKNSLGLIVALDYKREAQGELYWDDGVSKDTVTEKYILYNFSVTSNRLQAKIINNTY
MDPDNLMFTDIIILGMDKQPTNFTVLLSNSPTPVSNVNYNVSSKVVKISDLKGLVLGQEF
SIGWKLPVSDLEKFNCYPEDPAVSEENCRQRGCLWESTTLPGVPTCYYDTIPSYAASNIQ
YLPTGITTELAYLGAPNSARAASASGSLSATVSFLQLSVIYHTENMLQFKIFDPTNKRYE
VPVPLNTPPSPSGSPENRLYDVRIQNNPFGIQILRKNSSTVIWDSQLPGFTFNDMFLSIS
TRLPSQYIYGFGETEHTAFRRDMNWTMWGMFARDEPPAYKKNSYGVHPYYMALEEDGSAH
GVLLLNSNAMDVSFQPTPALTYRTTGGILDFYIVLGPTPELVTQQYTELIGRPAMTPYWA
LGFQLSRYGYQNDIEISQLYDAMMAAQIPYDVQHVDIDYMDRKLDFTLSPNFKNLSLLID
EMKKDGMRFILILDPAISGNETQYLPFTRGQENNVFIKWPGKNDIVWGKVWPDLPNVNVD
TSLDHETQVKLYRAHVAFPDFLRNSTVAWWKTEIKELYLNPRDSTKSLKFDGLWIDMNEP
SNFVNGSVKGCSDEILNNPPYMPYLESRDKGLSIKTLCMESEQILPDGSRVRHYDVHSLY
GWAQTRPTYEAVQEVTGQRGVVITRSTFPSSGRWGGHWLGDNTAAWDQLKKSIIGMMEFS
LFGIPYEQIFVASLEMPNTRCVFAGCNWGPFIHFPETTTPWGQGDKILWPGIQPSRCSQE
KSSRPDTPCCPTSTL
NT seq 4728 nt NT seq  +upstreamnt  +downstreamnt
atggcaaggaaactcactatattggaagtccttctgatcatcttcttcctaactgtactg
gccttagatatcttcttgatgttttttgtgttgaatattgaagcgactgcatttgctcca
gagtgcccagagatccctgaatcagagaggatagactgtgctcctggccaggtggtgaca
gaggatgtctgccgccagcaacataggtgctgctggaagcctgtgtcagatattaatgtc
cctacgtgcttcttccccaggaattggggctacaaagtcattgatagccagaataataca
aggacagccctagagtttacagcccacttgaaaaagttgtcattcccatctctgtttgga
tatgatgtcgacgaagccttcttcacagctgagtatcagacatccaatcgtttccatttt
aagatcaatgataccaataacatacgctatgaagtccagcatgaaaatattaacctgttt
aataggactaatagagccatcaatttcaactattacctagaggtcattcataaacccttc
agcatcaaaataataaggaagagcaatggaagagtcttattggacacgagcatcgggccc
ttgcagttcgcccagcagtacctgcagctgtccttccgactgcccagtgccactgtgtat
gggctgggagagcatgtacatcagcagtaccgccacaacatgacctggaagacctggccc
atcttcactcgagatgctgctcccaccgagggcatgattaatctgtatggagctcataca
ttcttcctgtgccttgaagacatcagtggcttctcttttggggtttttctgttgaacagt
aatgccatggaggtcaccctccagcctgctcctgcaatcacttaccgcacaactggaggc
atccttgacttttatgtattcctgggaaatactccagaacaagtgattcaggaatacctg
gagctcattggacgaccgttcttgcctccctactggagtcttggtttccagctcagtcgc
aggaactatggtggcatcaatggattgaaggaggttgtgaaccgaaatcgtctagctcag
atcccttatgatgtccagtactctgacatagactacatggatggaaataaggatttcact
attgataaagtggctttctctaatctctcaaattttgtcaacgagttacataaccaagga
atgaaatatgtaatcattatgaatcctggcatctcaaataactctggctaccagccctat
gtgaatggaagtacaaagagagtatggatcttgggggacaatggctttgttcttgggaag
gggtacccaggatggacagtgtttcctgattatagtaatccgacttgcgttgagtggtgg
agagagcagttcagtgcatttaataaaattctccagttcgatggagtgtggattgaaatg
gatgaagtctccagctttctccaagattccgatcgcaagtgtgagcggaacagcttgaac
tttcctcctttcgttccccaaattctggaccgctcactttttgccggaaccctctgcatg
gatgcagaactttactggggtcttcactatgatgtccacagcttgtatggctactccatg
gcaaaagctacacactcggccatggagaatatctttcccggaaaaaataacttcatctta
tcccgctctacttttgctggatctggcaaatttgctggacattggttgggggataatgcc
gccacatgggatgatctccgatggtccatcccaagtatccttgagttcaacctatttggt
atccccatggtaggtgccaacatctgcggttatacaaaaaatgtcacagaggacctctgc
acaagatggatgcagcttggagcattttatccactatcgaggaatcacaatggacctgag
ttcagggaccaggatcccgctgcctttggtgaacactctctgctgctgaaatcctccaga
cattacctgaacatccgctacaccctgctgccctacctctacacccttttctaccgagct
cacacccggggggatactgtagcaaggccactggtccatgagttctatcaggacccagct
acatgggatgtgcacgagcagttcttatgggggcctggactcctcatcacccctgtttta
tatgagggtgtggacctagtgaaagcatacataccggacgccatctggtacgactacgag
accggggtagccatgcagtggaggaaacaatcagtggagatgcagctgccacttgataag
ataggacttcacctccgaggaggcttcatatttcccacccagcaacccagcacaaccacg
gaaatcagtcggaagaattccctgggactcattgttgccttggactataagagagaagca
cagggagagctgtactgggatgatggtgtatctaaagatactgtaactgaaaagtatatt
ctgtataatttttctgtcacctcgaaccggctacaggcaaaaattataaataatacatat
atggaccctgacaacctcatgtttacagatatcataatcttgggaatggacaagcaacct
actaattttactgtcttacttagtaattctcctacccccgtttcaaatgttaactacaat
gtttcatcaaaggtggtgaagatcagtgatctcaagggactggtacttggtcaagaattc
tccattggatggaaacttccagtcagtgacctggagaaattcaactgctatcctgaggac
cctgctgtctctgaggagaattgcaggcagcgggggtgcctttgggagtccacaactctt
cctggcgtgcccacctgttactacgataccatccccagctacgccgccagtaacatccag
tacctgcctacgggcatcaccacagagcttgcctacctgggagcccccaactcagcccga
gcagcctcggcatctggctctctctctgcaacggtcagcttcctccagttgagcgtgatc
taccacacagaaaacatgctgcagttcaagatctttgatcccacaaacaaaaggtacgag
gtcccagtgcctctgaacacccctccttctccatctggctctcctgaaaaccgtctgtat
gatgtcaggattcagaacaatccttttgggatccagattctacgaaaaaactccagcacc
gtaatttgggattctcagctccctggcttcaccttcaacgacatgttcctctccatttct
actcgcctcccctctcagtacatatatggctttggggagacggagcacacagctttcaga
agagatatgaactggaccatgtggggaatgtttgctcgtgatgagccaccagcatacaag
aagaattcctatggtgtccacccgtactacatggcactggaggaagatggcagtgcccat
ggagtgctcctgctaaacagcaatgccatggatgtgtcattccagcccactcctgccctg
acataccgcaccacaggagggattttggacttttatattgttttggggccaacccctgag
cttgtaactcaacaatacactgagttgattggtcggccagcaatgactccatactgggcc
ttgggattccaactaagtcgctatggataccagaatgacattgagatctcccaattgtat
gatgcaatgatggcggcccagattccctatgatgtccagcatgtagacatcgattacatg
gaccggaagctggacttcacactcagccccaacttcaaaaacctcagtctcctgattgac
gaaatgaagaaagatggcatgagattcattctcattctggacccagccatttctggcaat
gagactcagtatctcccattcaccagagggcaggagaacaatgtattcatcaaatggcct
ggcaagaatgacattgtctggggaaaggtttggccagatctacccaatgtgaatgtggat
acatcccttgaccatgaaactcaggttaagctttacagagcccacgttgcttttcctgac
ttcttacgtaatagcacagttgcgtggtggaagacggaaataaaagagctctatctaaac
cctcgagactcaacaaagagcttgaagtttgatggactgtggattgatatgaatgagccc
tcaaactttgtgaatggatctgtcaaaggctgcagtgatgaaattcttaataatccaccc
tatatgccatatttggagtccagggacaagggcctgagcatcaagaccttgtgcatggag
agtgagcagatcctgccagatggctcacgggtgcggcactatgacgttcacagcctgtat
ggatgggcccagaccagacccacatatgaagctgtgcaggaggtgacgggacagcgaggg
gtcgtcatcacccgctccacattcccctcttctggccgctggggaggccactggctgggt
gacaacacggccgcgtgggaccagctgaagaagtctatcattggcatgatggagttcagt
ctctttggaataccgtatgagcagatatttgtggcttctttggaaatgccgaatacgaga
tgtgtattcgctggatgcaactgggggccttttatccattttccagaaaccacaacacca
tggggacaaggagacaagatcctgtggcctggaattcaaccttcgagatgttctcaagaa
aagtcctcgagaccagatacaccctgctgccctacctctacactctga

DBGET integrated database retrieval system