KEGG   Canis familiaris (dog): 483314Help
Entry
483314            CDS       T01007                                 

Gene name
CASKIN2
Definition
(RefSeq) caskin-2
  KO
K21952  CASK-interacting protein
Organism
cfa  Canis familiaris (dog)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cfa04131]
    483314 (CASKIN2)
Membrane trafficking [BR:cfa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    483314 (CASKIN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank_5 SAM_1 Ank_4 Ank Ank_3 Caskin-Pro-rich SAM_2 Caskin-tail SH3_2 Caskin1-CID SH3_9 SH3_1
Motif
Other DBs
NCBI-GeneID: 483314
NCBI-ProteinID: XP_005624157
Ensembl: ENSCAFG00000004787
VGNC: 38731
UniProt: E2RAV0
LinkDB All DBs
Position
9
AA seq 1202 aa AA seqDB search
MGREQDLILAVKNGDVTGVQKLVAKVKAAKTKLLGSTKRLNVNYQDADGFSALHHAALGG
SLELIALLLEAQATVDIKDSNGMRPLHYAAWQGRLEPVRLLLRASAAVNAASLDGQIPLH
LAAQYGHYEVSEMLLQHQSNPCLVNKAKKTPLDLACEFGRLKVAQLLLNSHLCVALLEGE
AKDPCDPNYTTPLHLAAKNGHREVIRQLLRAGIEINRQTKTGTALHEAALYGKTEVVRLL
LEGGVDVNIRNTYNQTALDIVNQFTTSQASREIKQLLREASGILKVRALKDFWNLHDPTA
LNVRAGDVITVLEQHPDGRWKGHIHESQRGTDRVGYFPPGIVEVVSKRVGVLAPRLPSAP
TPLRPGFSRTPQPPADDPLHPLTYGQLPRVGLSPDSPAGDRNSVGSEGSVGSIRSAGSGQ
SSEGTNGHGTGLLIENAQPLPSMGEDQVLPGLHALPLADNLNHRPLVHYRSGEQLFTQDV
RPEQLLEGKDAQAIHNWLSEFQLEGYTAHFLQAGYDVPTISRMTPEDLTAIGVTKPGHRK
KIASEIAQLSIAEWLPNYIPADLREWLCALGLPQYHKQLVSSGYDSMGLVADLTWEELQE
IGVNKLGHQKKLMLGVKRLAELRRGLLQGEVPVEGGGRRLARGPELMAIEGLENGDGPAA
TGPRLLTFQGSELSPELQAAMAGGGPEPLPLPPARSPSQESIGARSRGSGHSQEQPAPQP
SGGDSSTPQERNLPEGTERPSKLCSPPPGQGPPPYVFMHPQASPSSPAPGPPPGAPRAFS
YLAGPPATPPDPPRPKRRSHSLSRPGPAEGEAEGEAEGPADSALGSYATLTRRPGRSALA
RTSPSPTPARGAPRSQSFALRARRKGPPPPPPKRLSSVSGPTTEAPSLDGSPGPKEGASG
PRRRTLSEPTGPSEPPSPPVPAGPVSDTEEEEPGPEGTPPSRGSSGEGLPFAEEGNLTIK
QRPKPAGPPPREAPVPAGLDFNLTESDTVKRRPKCREREPLQTALLAFGVASATPSPSAP
LPSQTPSEPSSAAPSPPRLDPSSLPTQGAPAPLSPSPQTQPSAPPCPGPALESSTGDWRH
GETEPPASPAALIKVPGAGTAPKPVSVACTQLAFSGPKLAPRLGPRPVPPPRPESTGAVG
SGRAQQRLEQTSSSLAAALRAAEKSIGAEEREGPPSTSAKHILDDISTMFDALADQLDAM
LD
NT seq 3609 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgtgaacaggacctgatcctcgccgtcaagaacggagatgtgactggtgtgcag
aaacttgtggctaaggtcaaggccgcaaagacaaagctcctcggctccacgaagagactc
aacgtcaactatcaggatgctgatggattctctgctctccatcatgctgccttggggggc
agcctggagctcatagccttgctgctggaggctcaggccactgttgacatcaaggacagc
aatggcatgcgcccgctgcactacgcagcctggcagggccggctggagccagtgaggctg
ctgctgcgcgcctctgcagctgtcaacgccgcctcgctggatgggcagatcccactgcat
ctggctgcccagtatggacactatgaagtgtcagaaatgctcctccagcatcagtccaac
ccatgcctggtcaacaaggcaaagaagacacccctggatctggcctgtgagtttgggcgg
ctcaaggtggcccagctgctactgaacagtcacttgtgtgtggcgctgctggagggtgag
gccaaggacccgtgtgaccccaactacaccacacccctgcacttggctgccaagaatggc
cacagagaggtcatcagacagctccttagagcggggatcgagatcaaccggcagactaag
accggcacggcgctccacgaagccgcactgtacggcaagacggaggtggtacggctgctc
ctggagggcggagtggacgtgaacattcggaacacgtataaccagacagcactggacatc
gtgaatcagttcaccacctcccaggccagccgagaaatcaagcagttactgcgggaggcc
tcagggatcctgaaggtgcgagcgctcaaggatttctggaacctccacgatcccactgct
ctcaatgtccgggcaggggatgtcatcacggtgcttgagcagcatcccgatggccgctgg
aagggccacatccatgagagccagaggggcacggaccgtgtgggctacttccccccaggc
atcgtggaggtggtcagcaagcgggtgggcgtcctcgcacctcgcctcccatctgctccc
acccccctgcgcccaggcttctctcggacaccacagccccctgccgatgaccccttacac
cctttaacctatggccagcttcctcgggtgggcctcagcccagacagcccagcaggtgac
aggaatagtgtgggcagtgagggcagcgtgggcagcatccgcagtgccggcagcgggcag
agttccgagggcaccaatggccatggcactggccttcttattgagaacgcccagcctctg
ccttccatgggagaggatcaggtgctgccgggattgcacgcactacccctggcagacaac
ctgaaccaccgccctctggttcactaccgctctggggaacagctcttcacccaggatgtg
aggccggagcagctgctggaggggaaggacgctcaggccattcataactggctgagtgag
ttccagctggaaggctacaccgcccactttctgcaggctggctatgatgtgccaaccatc
agccgtatgactcctgaggacctgacggccatcggggtgaccaagcctgggcacaggaag
aaaatcgcctcagagattgctcagctcagcattgctgagtggctgcccaactatatcccg
gcggacctgcgggagtggctgtgtgcgctagggctgccgcagtaccacaagcagttagtg
agcagcggctacgactccatggggctggtggccgacctcacctgggaggagctgcaggag
atcggagtcaacaagctcggtcatcagaagaagctgatgctgggagtgaagcggctggcc
gagctgcggcggggcctcctgcagggggaggtcccggttgaaggcggcggccgccggcta
gccagaggcccggagctcatggccatcgaggggctggagaatggggatggtccagctgcc
accggcccacgcctcctcacctttcagggcagcgagctaagcccagagctacaggcagcc
atggctgggggtggccccgagccactccccttgccccccgcccgctcccccagccaggag
agcattggagcacgctcacgagggtccgggcactcacaggaacagcctgccccccagccc
agtggtggagactccagcaccccacaggagagaaaccttccagagggcacggagcgaccc
tctaagctttgttccccacctcctggccaagggcctcccccttacgtttttatgcatccc
caggcctcaccctctagcccagctccggggccacctcccggggcaccccgtgccttctcc
tacttggctggtcctcctgccactcctccggacccaccccggcccaagcgccggtcacac
agcctgagccgtccgggccctgcggagggggaagcagagggggaggctgaggggccagcg
gacagtgccttgggcagctatgccaccctcacccggcgaccaggacgcagtgccctagcg
cggaccagccctagcccgaccccagctcgaggggctccccgcagccagtcctttgccctt
cgtgcccgacgcaaaggcccgccacccccaccccctaaacgtctcagttcggtttctggc
cccaccacagaggcgccttcgctagatggaagcccggggcctaaggagggggcctctggg
ccccgaaggcgaacactgagtgagccaactggaccctcggagccccccagcccgcctgtg
ccagcagggcccgtgtcggacacagaggaggaggagccagggcctgaggggacgccccca
tctcggggcagctcaggggaggggctcccatttgcagaggaggggaacctgaccatcaaa
cagcggccgaagccagctggcccccctccccgggaggcgcctgtgcccgctggcctggat
ttcaacctcacagagtcagacactgtcaagcggagacccaaatgccgggagagagagcct
ctgcagacggccctgctggccttcggggtggccagtgccacgcccagcccctctgccccc
ctgccctcccagacccccagcgagccctcctcagctgctcccagccctccccggctggac
cctagcagccttccaactcagggagctccagcacccctttctcccagcccccaaacccag
ccctctgcacccccctgccccgggcctgctctggaaagctcaacaggtgattggcggcac
ggggagacagagcccccagcttcccccgctgccctcatcaaggtgccaggtgcaggaaca
gcccccaagcctgtgtctgtggcctgcacccagctggcattttcaggcccaaagctggct
ccccggcttggcccccgccccgtgcctcctccaaggccagagagcactggggctgtgggc
tctggccgggcccagcagaggctggaacagaccagctcctccctggcagctgcattacgg
gccgcagagaagagcattggcgctgaggagcgagagggccctcccagcacctccgccaag
cacattttggatgacatcagcaccatgtttgatgccctggctgaccagctggatgccatg
ctagattga

DBGET integrated database retrieval system