KEGG   Canis familiaris (dog): 483352Help
Entry
483352            CDS       T01007                                 

Gene name
GAA
Definition
(RefSeq) lysosomal alpha-glucosidase isoform X1
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00052  Galactose metabolism
cfa00500  Starch and sucrose metabolism
cfa01100  Metabolic pathways
cfa04142  Lysosome
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    483352 (GAA)
   00500 Starch and sucrose metabolism
    483352 (GAA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    483352 (GAA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cfa04147]
    483352 (GAA)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     483352 (GAA)
Exosome [BR:cfa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   483352 (GAA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 483352
NCBI-ProteinID: XP_005624079
Ensembl: ENSCAFG00000005589
VGNC: 41044
LinkDB All DBs
Position
9
AA seq 979 aa AA seqDB search
MGHHQRPMINQLCSGLQDPARGPQVPPTMDARWPPSSRPLLGVCTLVCLATAAFLGHVLL
RDSLVAPQEQRRFSQGPEQLYHAHQQGARNPGPQPSPGHPGRPRAAPTQCDVPPNSRFDC
APDKAITQQQCEARGCCYRPATPWPQHPRMGQPWCFFPPSYPSYKLENLTTTETGYTAAL
TRSTPTFFPKDILALRLDVLLETESRLHFTIKDPTNRRYEVPLETPRAHGRALATLYSVE
FQEEPFGVVVRRKLDGRVLLNTTVAPLFFADQFLQLSTSLPSQYIAGLAEHLGSLMLSTN
WTRVTLWNRDIAPSPNVNLYGSHPFYLALEDGGSAHGVFLLNSNAMDVVLQPSPALSWRS
TGGILDVYVFLGPEPKSVVQQYLEVVGSPFMPPYWGLGFHLCRWGYSSTAITRQVVENMT
RAHFPLDTQWNDLDYMDARRDFTFNKDGFRDFPAMVQELHRGGRRYVMIVDPAISSSSPP
GSYRPYDEGLRRKVFITNETGQPLIGKVWPGFTVFPDFTSPTALDWWQDMVSEFHAQVPF
DGMWIDMNEPSNFVRGSVYGCPDNDLENPPYVPGVVGGTLRAATICASSRQLLSTHYNLH
NLYGLTEAIASHRALVKARGTRPFVISRSTFAGHGQYAGHWTGDVWSSWEQLSYSVPEIL
LFNLLGVPLVGADVCGFLGNTSEELCVRWTQLGAFYPFMRNHNDLNSLPQEPYRFSATAQ
EAMRKALALRYSLLPHLYTLFHRAHVGGETVARPLFLEFPEDPHTWTVDRQLLWGEALLI
TPVLEAGKVEVTGYFPAGTWYDLQTVPVGAFGSLPPPPPAPLMSTIHSKGQWVTLPAPLD
TINVHLRAGHIIPLQGPGLTTTESRKQPMALVAALGTNGEARGELFWDDGESLGVLERGA
YTEVVFLARNDTIVNELVRVTSEGAGLQLRKVTVLGVAAGPRQVLCNGVPVAFTYNPDTK
TLDIPVSLTMGEQFLISWS
NT seq 2940 nt NT seq  +upstreamnt  +downstreamnt
atggggcatcaccaacgaccgatgattaatcagctgtgctcgggcctccaggacccagcc
cgcggcccgcaggtgccaccgaccatggacgcgaggtggcctcccagctcccggcccctg
ctgggggtctgcaccctcgtctgcctggccaccgctgccttcctgggccacgtcctgctc
cgtgactccttggtggctccccaagagcaacggcgcttctcccaagggcccgagcagctt
tatcatgctcaccagcaaggagcccgtaacccaggcccccagcccagcccagggcacccc
ggcaggccccgagcggcacccacacagtgtgatgtgccccccaacagccgtttcgactgt
gccccggacaaggccatcacccagcagcagtgtgaggcgcggggctgctgctacaggccc
gcgacgccctggccccagcacccccggatgggacagccctggtgcttcttcccacccagc
tacccgagttacaagctggagaacctgaccaccacggagacgggctacacggccgctctg
acccgtagcaccccaaccttcttccccaaggacattctggccttacggttggacgtgctg
ctggagacggagagccggctccacttcacgatcaaagatcccaccaacaggcgctatgag
gtgcccctggagaccccgcgggcccacggccgcgccttggccacactctacagcgtggag
ttccaggaggagcccttcggggtggtcgtgcgccggaagctggacggccgggtgctgctg
aacacgacggtggcccccctgttcttcgccgaccagtttctgcagctgtccacctccctg
ccgtcccagtacatcgctggccttgccgagcatctcggctccctgatgctcagcaccaac
tggaccagggtcaccctctggaaccgggacatcgccccctcgcccaacgtgaacctgtac
gggtcccaccctttctacctggcgctggaggatggcgggtcagctcatggggtcttcctg
ctgaacagcaatgccatggacgtggtcctgcagccgagcccggccctcagctggaggtcg
acaggcgggatcctggacgtgtacgtcttcctgggcccggagcccaagagcgtggtacag
cagtacctggaagtcgtgggctccccgttcatgccaccctactggggcctgggcttccac
ctgtgccgctggggatactcgtccacagccatcacccgccaggtggtagagaacatgacc
cgggcccacttccccctggacacgcagtggaacgacctggattacatggacgccaggagg
gactttactttcaacaaagacggcttcagggacttcccggccatggtgcaggagctccac
cggggcggccggcggtacgtgatgatcgtggacccggccatcagcagctccagcccccct
ggcagctaccgaccctatgacgagggtctgcggagaaaggttttcatcaccaatgagacg
gggcagccgctgattgggaaggtgtggcccgggttcactgtcttccccgacttcaccagc
cccacggccctggactggtggcaggacatggtgtctgagttccatgcccaggtgcccttc
gacggcatgtggattgacatgaacgagccatccaacttcgtgaggggctcggtgtatggc
tgccccgacaatgacctggagaacccgccctacgtgcccggggtggttggcgggaccctg
cgggcagccaccatctgtgcctccagccgccagctgctctccacgcactacaacctgcac
aacctgtatggcctgacggaagccatcgcctcccacagggccctcgtgaaggctcggggg
acgcgcccctttgtgatctcccgctcaaccttcgctggccacggccagtatgccggccac
tggacaggggacgtgtggagcagctgggagcagctctcgtactctgtaccagaaatcctg
ctgttcaacctgctgggggtgccgctggtcggggccgacgtctgtggcttcctgggcaac
acgtcagaggagctgtgcgtgcgctggacccagctgggggccttctatccgttcatgcgg
aaccacaacgacctcaacagcctgccccaggagccctacaggttcagcgcgacggcgcag
gaagccatgaggaaggcgctcgccctgcgctactcgctgctgccccacctctacacgctc
ttccaccgggcacacgtggggggcgagaccgtggcccggcccctcttcctcgagttccct
gaagacccccacacctggaccgtggaccgccagctcctgtggggggaggctctgctcatc
acccccgtgctcgaggccgggaaggtcgaagtgactggctacttccccgctggcacatgg
tacgacctgcagacggtgcccgtaggggccttcggcagcctcccgcccccacctccagct
ccgctcatgtccaccatccacagcaaggggcagtgggtgacgctgccagccccgctggac
accatcaacgtccacctccgggctgggcacatcatccccctgcagggccctggcctcacg
accacagagtcccgaaagcagcccatggccctggtcgcagccctgggcacaaacggggaa
gcccgaggggagctgttctgggacgacggggagagcctcggggtgctggagcgcggggcc
tacacggaggtggtcttcctggccaggaacgacaccatcgtgaacgagctggtacgtgtg
actagcgagggggccggcctgcagctgaggaaggtgaccgtcctgggggtggccgcgggc
cccaggcaggtcctctgcaacggcgtccctgttgccttcacctacaaccctgacaccaag
accctggacatccccgtgtcactgacgatgggagaacagtttctcatcagctggtcttaa

DBGET integrated database retrieval system