KEGG   Canis familiaris (dog): 483898Help
Entry
483898            CDS       T01007                                 

Gene name
LCT
Definition
(RefSeq) lactase-phlorizin hydrolase
  KO
K01229  lactase-phlorizin hydrolase [EC:3.2.1.108 3.2.1.62]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00052  Galactose metabolism
cfa01100  Metabolic pathways
cfa04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    483898 (LCT)
 Organismal Systems
  Digestive system
   04973 Carbohydrate digestion and absorption
    483898 (LCT)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.62  glycosylceramidase
     483898 (LCT)
    3.2.1.108  lactase
     483898 (LCT)
Chaperones and folding catalysts [BR:cfa03110]
 Intramolecular chaperones
  Others
   483898 (LCT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1
Motif
Other DBs
NCBI-GeneID: 483898
NCBI-ProteinID: XP_022261774
VGNC: 42616
LinkDB All DBs
Position
19
AA seq 1804 aa AA seqDB search
MELAWNSFFIVLLSFSCWGLDWESDRNFMSAAGPLTNDLLYNLSGSLGNKTSNFAAEDKS
IYVCQQPVPAFLLEYFSSVRASEITHYKVFLPWAQLLPAGSSKNPDSKTVQCYRRLLETL
KAAQLQPLVVLHHQNLPASTVQRSEVFAHLFADYATFAFHSFGDLVEIWFTFSDLEEVIK
ELPHQESRSSRLQTLTDAHRKAYEIYHEKYASQGGKLSVVLRAEAISEILLQPSTSSLAK
GAVDFLSLDVSYECQSEASLPQKLSKLQTIEPKVNIFIFNLRFQDCPSTRKNSALLFSIR
KAINENQNLTIGFDLNTFLSCSPSSKKRSFMHHVLTKVIDWKESFGFPDFQLEFLLFTLD
SAGTALSQAICFYCSQLFVLFLSQHLYIFCFVLSTHFKPAGQINKPKAAAACKALSREYE
RWKEEIGQNFSLTTLRHCISFFLPYEVAHLILKTHARVWHHYNSYYRPQQQGRVGIVLNS
DWAEPLSPERPEDVRASELYLHFMLGWFAHPIFVDGDYPPALKARIQQVNQQCPSPVAQL
PEFTEAEKQLLKGSADFLGLSHYTSRLISKTQQDSCIPSYDAIGGFTQHVDPAWPQTSSP
WIYVVPWGIRRLLKFVSLEYTRGKVPIYLAGNGMPIGETEDLFEDSLRVDYFNKYINEVL
KAIKEDLVDVRAYIARSLIDGFEGPSGYSQRFGLHHVNFNDSSKPRTPRKSAYFFTSIIE
KNGFLPKVVKSLPPPRTADFPTKIRAFPFPSDVPSKAKVVWEKFSNQPKFERDLFYHGTF
RDDFLWGVSSSAYQIEGAWDADGKGPSIWDNFTHTPGNNVKDNSTGDIACDSYNQLDADL
NMLRALKVKAYRFSLSWSRIFPTGRNSSINRYGVDYYNRLINGLVASNISPMVTLFHWDL
PQALQDIGGWENPSLIELFNSYADFCFQTFGDRVKFWMTFNEPTYQAWLGYGSGDFPPKV
KDPGWAPYRIGHAIIKAHAKVYHTYDEKYRQEQKGVISLSLSTHWAEPKSPELPRDVEAA
DRTLQFSLGWFAHPIFRNGDYPDAMKWKVGNRSELQHLATSRLPSFTEEEKSYIRATADV
FCLNTYSSRIVQHKTPRLNPPSYEEDQETTEEEDSSWPSTAVNRAAPWGTRRLLNWIKEE
YGDIPIYITENGVGLGNSKVDDTDRIFYHKTYINEALKAYRLDGVDLRGYSAWSLMDNFE
WLNGYTVKFGLYHVDFNNRNRPRTARASARYYTEVITNNGMPLPKEDEFLYGHFPEGFIW
SAATAAYQVEGAWRADGKGLSIWDTFSHTPLKIGNDDNGDVACDSYHKIAEDVVALQNLG
VSHYRFSVSWSRVLPDGTNKYVNEAGLNYYVRLIDALLAANIKPQVTIYHWDLPQALQDV
GGWENETIVQRFKEYADVLFQRLGDKVKFWITLNEPFVIATQGYGYGTAAPGISFRPGTA
PYVVGHNLIKAHAEAWHLYNDVYRASQGGVISITISSDWAEPRDPSNQQDVEAARRYVQF
MGGWFAHPIFKNGDYNEVMKTRIRDRSLAAGLTKSRLPEFTESEKRRINGTYDFFGFNHY
TTILAYNLDYASWISSFDADRGVASITDRSWPDSGSFWLKITPFGFRKILNWLKEEYNNP
PIYVTENGVSQRGERDLNDTLRIYYLRSYINEALKAVQDKVDLRGYTVWTLMDNFEWATG
FAEKFGLHFVNYTDPSLPRIPKASAKFYASIVRCNGFPDPAAGSHPCLQPEDAEATASPM
REEEVQFLGLTLGATEAQTALYVLFSLAILGVCCVAFLSYKYCKHSKQGKTQAGQQELST
ISAF
NT seq 5415 nt NT seq  +upstreamnt  +downstreamnt
atggagctggcttggaactcattctttattgtcctcctaagcttttcatgctggggcttg
gattgggaatctgatagaaacttcatgtcagctgctggtcctctcaccaatgacttgcta
tacaacctgagtggttcactgggaaacaagacttctaattttgcagcagaagacaaaagc
atttatgtttgtcaacaacctgtgcctgctttcctgctggagtatttcagcagtgttcgt
gccagtgagatcacccattataaagtattcctaccgtgggcacaacttctcccagcagga
agctccaagaacccagacagcaaaacagtgcagtgctaccggcggttgcttgagaccctc
aaggctgcacagcttcagcccctggtcgttctgcatcaccagaatctccctgccagcact
gtccagagaagtgaagtctttgctcatctctttgcagactatgccacattcgccttccac
tcctttggggacctggttgagatctggttcacgtttagtgacttggaggaagtgataaaa
gagctgccccaccaggaatcaagatcttcacgtctccagaccctcactgatgcccacaga
aaagcctatgaaatttaccatgaaaaatatgcttctcaaggtggaaagctctctgtggtc
ctcagagctgaagctatctcggagatcctgctgcaaccctccacatcttcccttgccaag
ggcgcagttgatttcctctctcttgatgtgtcttatgaatgccaaagcgaggcaagtttg
ccacagaagctgagtaaattacagactattgagccaaaagtgaacattttcatcttcaat
ctaagattccaggactgcccttccaccaggaagaactctgcgctgctctttagcattcgc
aaagccataaatgaaaaccagaatctcaccattgggtttgatcttaatactttcctaagc
tgttcaccaagttccaagaaaaggagcttcatgcaccatgtgttgacgaaggtcatagac
tggaaagaatcatttggcttcccagactttcagctagagttcttgctcttcaccttagac
tctgctgggacagccctgtcccaggccatatgcttctattgctcccagctctttgtactg
ttcctctcccaacacttgtatatcttctgttttgtcctctcaactcacttcaagccagca
ggtcaaatcaacaaacccaaagcagctgctgcatgtaaggctttgtccagggagtatgaa
cggtggaaagaggagataggtcagaacttctctctgaccacactcagacactgtatttcc
ttctttcttccttacgaggtggctcacttgatcctcaagactcatgccagagtttggcac
cactataatagctactatcgtccacagcagcagggacgtgtaggcattgtgttgaactca
gactgggcagagcctctgtccccagagaggcccgaggacgtcagagcctcggaactctac
ttgcacttcatgctgggctggtttgcacaccccatttttgtggatggagactaccctcct
gccctgaaggctcggatccaacaggtgaaccaacagtgccccagtcctgtggcccagctc
cctgagtttactgaagcagagaagcagctcctgaaaggctccgctgattttctgggtctg
tctcattatacctcccgcctcatcagcaagacccaacaagattcctgcatccccagctat
gatgccattggaggctttacccaacatgtggaccctgcatggccccagacctcatcccct
tggatttatgtggtgccctggggcataaggaggctgttaaagtttgtgtctttggaatac
acaagaggaaaagttccgatctacctggctgggaatggcatgcctataggggagactgaa
gatctctttgaggattccttgagagtagactacttcaataaatatatcaatgaggtgctc
aaggccatcaaggaggacctggtggatgttcgagcttacatcgctcgttccctcatagat
ggcttcgaaggcccctctggttacagccagaggtttgggctgcaccacgttaacttcaat
gacagcagcaagccaagaactcccaggaaatctgcctactttttcaccagcatcattgaa
aagaacggtttccttcccaaggtagtcaagagcctgccaccaccccgtacggccgacttt
ccaactaaaatcagagccttcccttttccatctgacgtgccctccaaggctaaagtagtt
tgggaaaagttctccaaccaacccaagtttgaaagagatttgttctaccacggcactttc
cgggatgactttctgtggggcgtgtcctcatcagcctatcagatcgagggagcttgggat
gctgatggcaaaggtcccagcatctgggataacttcacccacacaccagggaacaacgtg
aaagacaattccaccggagacatcgcctgtgacagctataaccaattggatgccgatctg
aatatgcttcgagctttgaaggtgaaggcctatcgcttctctctctcctggtctcggatt
ttcccaacagggagaaacagttctatcaacagatatggtgttgattattacaacagactg
atcaatggcttggtggcaagcaacatctcacccatggtgaccctattccactgggacctg
ccccaggccctccaggatattggaggctgggaaaatccttccttgattgagttgtttaac
agctatgcagacttttgtttccagacctttggggacagagtcaagttctggatgaccttc
aatgagcccacataccaggcatggttaggttacggctcaggggattttcctccaaaggtg
aaagacccaggctgggcaccttacaggattggccatgcaattatcaaagctcatgccaaa
gtctatcacacttatgatgagaaatacaggcaggaacagaagggggtcatctctttgagc
ctcagtacacactgggcagagcccaagtcaccggagctcccgagggacgtggaggcagct
gaccgaaccctgcagttttccctgggctggttcgcccaccctattttccgaaatggagac
tatcctgatgccatgaagtggaaagtggggaataggagtgagcttcaacacttagccacc
tcccgcctgccaagcttcaccgaggaagagaagagctacatccgagctacagctgatgtt
ttctgcctcaatacctactcctccagaatcgtgcagcacaagacacccaggttaaatcca
ccctcctatgaagaggaccaggagaccaccgaggaggaggactcctcgtggccttccaca
gccgtgaacagagctgcgccctggggcacgcgaaggctgctcaactggatcaaggaagag
tacggggacatccccatttacatcactgaaaacggggtggggctgggaaattccaaagtg
gacgataccgataggatattttatcacaaaacctacatcaatgaagctttgaaagcctat
agacttgacggcgtagaccttcgaggatattctgcgtggtctctgatggacaactttgag
tggctgaatggctacacagtcaagtttggactgtaccatgttgatttcaacaacagaaat
aggcctcgcacggcaagagcctccgccaggtactacacagaggtcatcaccaacaacggc
atgccgctgcccaaggaagatgagtttctctatggacattttcccgagggcttcatctgg
agtgcagccactgctgcgtatcaggttgaaggtgcatggagagcagatggcaaaggactc
agtatttgggacacgttttctcacacaccactgaagattgggaatgatgacaatggagat
gtggcctgtgacagttatcacaagattgctgaggacgtggtcgccctgcagaacctgggt
gtgtcccactaccgcttctctgtctcctggtctcgtgtcctcccagatggaaccaacaag
tacgtcaatgaagcaggcctcaactactatgtgcggctcatcgacgctctgctggccgcc
aatatcaagccccaggtgaccatttaccactgggacctgccccaggcactccaggatgtt
gggggctgggagaatgagaccattgtgcagcgctttaaagagtatgcagacgtgctcttc
cagaggctgggggacaaggtgaagttctggatcactctgaatgagccctttgtcatcgca
acccagggctatggctacgggacagcagctccaggaatctcctttaggcctggcactgcc
ccctacgttgttggccacaacctaataaaggctcacgctgaggcctggcacctgtacaac
gacgtgtaccgggccagtcaaggtggcgtgatttccatcaccatcagcagtgactgggct
gagcccagagacccctctaaccagcaggatgtggaagcagccaggagatacgttcagttt
atgggaggctggtttgcacaccctattttcaagaacggcgattacaacgaggtgatgaag
acacggatccgtgacaggagcctggctgccggcctcaccaagtctcggctcccggagttc
acggagagtgagaagaggaggatcaatggcacctatgacttttttggattcaatcactac
accaccatcctggcctacaaccttgactatgcctcatggatctcctcctttgatgcagac
aggggagtcgcctccatcacagatcgctcttggccagactctggttccttctggctgaag
ataacaccttttggcttcaggaagatactgaactggttgaaggaggagtacaacaacccc
ccaatttatgtaacagagaatggagtgtcccaacggggagaaagagacctcaatgacacc
ctaaggatctactacctccgcagttacatcaacgaagccctgaaagctgtgcaggataaa
gtggaccttcgaggatacacggtttggactctgatggacaattttgagtgggccacaggc
tttgcagagaagtttggtctgcatttcgtgaactacacagacccttctctgcctcggatc
ccaaaagcgtcagccaagttctacgcctctatagtccggtgcaatggcttccctgaccct
gctgcagggtcacacccttgtctccagccagaagatgctgaagctactgccagtcccatg
cgagaggaggaagttcagttcctggggttaacactaggtgcgacagaagcccagacagct
ttgtacgtactcttttctcttgcaattcttggtgtctgttgtgtggcatttctgtcatac
aagtactgtaagcactccaagcaagggaaaacacaagcaggccaacaggaactgagcaca
atttctgcattctga

DBGET integrated database retrieval system