KEGG   Canis familiaris (dog): 484295Help
Entry
484295            CDS       T01007                                 

Gene name
KMT5C
Definition
(RefSeq) histone-lysine N-methyltransferase KMT5C isoform X1
  KO
K11429  histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    484295 (KMT5C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cfa03036]
    484295 (KMT5C)
Enzymes [BR:cfa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     484295 (KMT5C)
Chromosome and associated proteins [BR:cfa03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     484295 (KMT5C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 484295
NCBI-ProteinID: XP_005616250
Ensembl: ENSCAFG00000002594
VGNC: 42495
LinkDB All DBs
Position
1
AA seq 505 aa AA seqDB search
MRLETFKSLAKLRAAPKWHSWGTAPAPTLCPPGQRQHGPWGTMGPDRVTARELCENDDLA
TSLVLDPYLGFRTHKMNVSPVPPLRRQHHLRSALEAFLRQRDLEAAYRALTLGGWMAHYF
QSRGPRQEAALKTHIYRYLRAFLPESGFTILPCTRYSMETNGAKIVSTRAWKKNEKLELL
VGCIAELREADEGLLRAGENDFSIMYSTRKRIAQLWLGPAAFINHDCKPNCKFVPADGNA
ACVKVLRDIEPGDEVTCFYGEGFFGEKNEHCECYTCERKGEGAFRLRPREPLPPRPLDKY
ELRETKRRLQQGPDRSRRQGPLGPRACAHLSPLHRDPFCAACQPLRPLPCGTRPDASPLW
LQWLSQPQLRARPRRRRRPQPRRAPALPVLRAARVSLHQWGGCGPRCCLRAEALVALGPA
PRAHWAPQQDWHWARRYGLPYVVRVDLSRVAAALPATPVPAPVGTPGPTPFPKQALAFAP
FSPPKRLRLVVSHGSIDLDVNGDGP
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgagactggagacctttaaaagccttgccaaactccgcgcagctcctaagtggcactcc
tggggcactgcccctgcccctaccttgtgccctccgggccagaggcagcatggtccgtgg
ggcaccatgggaccagacagagtgacagccagagagctgtgtgagaatgacgaccttgcc
accagcctagtcctggacccctacctcggcttccgtacccacaagatgaacgtcagccct
gtgcccccactgcggcgacagcaccacctgcgctcagcgctggaggccttcctgaggcag
cgggacctggaggctgcataccgggccctgacgctgggaggctggatggcccactacttc
cagagccggggcccgcggcaggaggctgccctcaagacccacatctatcgctacctccga
gccttcctgcctgaaagcggctttaccatcctgccctgtacacgctattccatggagaca
aatggagccaagattgtgtctaccagagcttggaagaagaatgagaagctggaactgctg
gtgggctgcatcgcagagctgcgggaggccgacgaggggctgctgagagctggcgaaaac
gactttagcatcatgtactccacccgcaagcgcatcgcacagctgtggctgggcccggca
gccttcataaaccatgactgcaaacccaattgcaagtttgtgccggcagatgggaatgca
gcctgtgtgaaggtgcttcgggacattgagccaggggatgaggtgacctgcttttatggt
gagggcttctttggtgagaagaatgagcactgtgaatgctacacgtgtgagaggaaaggc
gaaggagccttccgcctgcggcctagggaacccttgccccctcggcccctggacaagtac
gagctccgggagaccaaacggaggctgcagcagggcccagaccgtagtcgccggcagggc
cccctgggccccagggcctgtgcccacctgtccccgctgcaccgggacccattctgtgct
gcctgccagcccctgcgccccctgccctgcggcactcgccccgacgcctcgcccctctgg
ctccagtggctgtctcaaccccagctccgggcgcgcccccggcggcgccgacgcccccag
ccccggcgggcccctgcgctccctgtcctccgtgcagcccgcgtctccttgcaccagtgg
ggaggctgtggccctcgctgctgcctgcgagcagaagccctggtggccctgggcccagcc
ccccgagcccactgggcccctcagcaggactggcactgggcccggcgttatgggctgcct
tacgtggtgcgcgtggatctgagccgcgtggctgcagccctgcctgccacccccgttccc
gcccctgttgggaccccaggccccacccccttcccgaagcaggccctggcctttgccccc
ttcagcccacccaagcgtctgaggctggtggtcagccatggctccattgacctggacgtc
aacggtgacgggccatga

DBGET integrated database retrieval system