KEGG   Canis familiaris (dog): 484867
Entry
484867            CDS       T01007                                 

Definition
(RefSeq) cytochrome P450 4F6 isoform X5
  KO
K17726  phylloquinone omega-hydroxylase / docosahexaenoic acid omega-hydroxylase / leukotriene-B4 20-monooxygenase [EC:1.14.14.78 1.14.14.79 1.14.14.94]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00590  Arachidonic acid metabolism
cfa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    484867
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:cfa00199]
    484867
Enzymes [BR:cfa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.78  phylloquinone omega-hydroxylase
     484867
    1.14.14.79  docosahexaenoic acid omega-hydroxylase
     484867
    1.14.14.94  leukotriene-B4 20-monooxygenase
     484867
Cytochrome P450 [BR:cfa00199]
 Cytochrome P450, animal type
  CYP4 family
   484867
SSDB
Motif
Pfam: p450 TetR_C_28
Other DBs
NCBI-GeneID: 484867
NCBI-ProteinID: XP_005632817
Ensembl: ENSCAFG00000015931 ENSCAFG00000023401
LinkDB
Position
20
AA seq 445 aa
MIEDLGHYFRDVHLWWIGPFYPVLRLVHPKFVAPLLQAPATIVPKDMFFYNFLKPWLGDG
LLLSAGDKWSHHRRLLTPAFHFEILKSYVKIFNRSADIMHAKWKRLVSEGSTHLDMFEHI
SLMTLDSLQKCVFSFDSNCQESPSEYIAAILELSALVVKRNEQVLLYLDFLYNLSPDGRR
FRRACELVHNFTDAIIQERRHTLISRGSCDFLKSKTMDFIDVLLLAKDEAGKQLSDEDIR
AEADTFMFEGHDTTASGLSWVLFNLAKHPEYQERCRQEVQELLRDREPQEIEWDDLAQLP
FLTMCIKESLRLHPPVTVIARRCTQDIVLPDGRVIPKGNNCVLSIFGIHHNPSVWPDPEV
YNPLRFDPEIPQKRSPLAFIPFSAGPRNCIGQAFAMSEMKVVLALTLLRFRVLPHEEEPR
RKPELILRAEGGLWLRVEPLSARPQ
NT seq 1338 nt   +upstreamnt  +downstreamnt
atgatagaggatctgggccactacttccgtgatgttcatctctggtggatagggcctttc
taccctgtactgcggctcgtccatcctaagtttgttgcccccttgctccaggccccagcc
accatcgtacccaaggacatgtttttctacaacttcctgaagccctggctgggggatggg
ctcctgctgagtgctggtgacaagtggagccaccaccgccgcttgctgacacctgccttc
cactttgaaatcctgaaatcttatgtgaagattttcaacagaagtgcagacatcatgcat
gccaagtggaagcgcctggtgtcagaaggcagcacccatctagacatgtttgagcacatc
agcctcatgaccctggacagtctgcagaaatgtgtcttcagttttgacagcaattgccag
gagagtcccagtgaatatattgctgccatcttggagctcagtgcccttgtggtgaaacgg
aatgagcaggtcctcctgtacttggacttcctgtacaatctcagccctgatgggcggcgc
ttccgcagggcctgcgaactggtgcacaacttcacagatgctatcatccaggagcggcgc
cataccctcattagcagaggctcctgtgacttccttaagtccaaaactatggacttcatt
gatgtcctcctgctggccaaggatgaagcgggaaaacaattgtcagatgaggatattcga
gctgaagctgacaccttcatgtttgagggccatgacaccacagccagtggcctctcctgg
gtcctgttcaaccttgcaaaacacccagaataccaggagcgctgccggcaggaggtgcaa
gagctcctgagggaccgtgagcctcaagagattgaatgggacgacctggcccagttgccc
ttcctgaccatgtgcatcaaggagagtctgcggctgcacccacctgtcacagtcattgcc
cgccgatgtacccaggacatcgtgctccccgatggccgggttatccccaaagggaacaac
tgtgtcctcagcatatttgggattcatcacaacccatcagtctggccggatcctgaggta
tacaatcccttgcgctttgacccagaaatcccccagaagaggtctcccctggcttttatt
cccttctctgctgggcccaggaactgcatcgggcaggcgttcgccatgagcgagatgaag
gtggtgctggcgctcacgctgctgcgcttcagggtcctgccccacgaggaggagccgcgc
aggaagccggagctcatcctgcgcgccgagggcggactgtggctgcgcgtggagccgctg
agcgcgcgcccccagtga

DBGET integrated database retrieval system