KEGG   Canis familiaris (dog): 485441Help
Entry
485441            CDS       T01007                                 

Gene name
SETDB2
Definition
(RefSeq) histone-lysine N-methyltransferase SETDB2 isoform X1
  KO
K18494  histone-lysine N-methyltransferase SETDB2 [EC:2.1.1.43]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    485441 (SETDB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cfa03036]
    485441 (SETDB2)
Enzymes [BR:cfa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     485441 (SETDB2)
Chromosome and associated proteins [BR:cfa03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     485441 (SETDB2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    485441 (SETDB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET MBD Pectinesterase
Motif
Other DBs
NCBI-GeneID: 485441
NCBI-ProteinID: XP_005633922
Ensembl: ENSCAFG00000004341
VGNC: 46061
LinkDB All DBs
Position
22
AA seq 705 aa AA seqDB search
MGEKNGDAKTFWMDLEDDGKVDFIFEQVQNVLQSLKQKIKDGSATNKEYIQAMILVNEAT
ISNNSTLIKDHISVTQNEQENKSGSLPSTSYEDSFPEDCTSLSAKNKEIPPLENKVAYIR
EKKSFFNLPYRSHDCSRTCLMKTPLTFKGENPLQLPIKCHFQRRHAKTNSHSSALHVSYK
TPCGRSLRNVEEVFRYLLETECNYLFTDNFSFNTYVQLTRNYPKQEEIVSDVDISNGVES
VPISFCNEIDNRKLPHFKYRRTVWPRAYYLTSFSNMFTDSCDCSEGCIDITKCACLQLTA
RNAKTCPLSSNKITTGYKYKRLQRQIPSGIYECSLLCKCNRRICQNRVVQHGPQVRLQVF
KTEKKGWGVRCLDDIDRGTFVCIYSGRLLSRSNVEKPGAATDENGKDYIMKNMFSKKRKI
EVADCEVEVIPLDLETHNRSAATEECPPVFNNNIKEPVTDMKCNSISRIQYHSVIRSPKV
KTVIIQRNGKRMGFASSESVTSEDNDGFKPTQVHLNSNTKEMKKDSSSYQVKDSEDNLLI
ESDVIDITKCREESPSGGRCNQATTLDKQNIIKEFKAQVQKPQEERSPAYRNHQVFCDKE
FPSEAKNISPNSLKKFSKGNVFLLDATKEGNVGRFLNHSCCPNLLVQNVFVETRDRNFPL
VAFFTNRHVKARTELTWDYGYEAGTMPEKEILCQCGVNKCRKKIL
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atgggagaaaaaaatggtgatgcaaaaactttctggatggatctggaagatgatggaaaa
gtggacttcatatttgaacaagtgcaaaatgtgctgcaatcactgaaacaaaagatcaaa
gatgggtctgccacaaataaagaatatattcaagcaatgattctagtgaatgaagcaacc
ataagtaacaattccacattgataaaggatcatatatctgtgactcagaatgaacaggaa
aataaatcaggttcattgccctctacatcatatgaagactcctttccagaagactgtaca
tctctatctgcaaaaaataaggaaattcctcctttggaaaataaagttgcctacattaga
gaaaagaaatcattttttaatctaccttaccgaagtcatgactgctctcgaacttgtctg
atgaaaacaccactgaccttcaagggagaaaaccctctgcagctaccaatcaaatgccac
ttccaaagacgacatgcaaagacaaactctcattcttcagcactccatgtgagttataaa
accccttgtggaaggagtctacgaaacgtggaagaagtttttcgttacctgcttgagaca
gagtgcaactatttatttacagataatttttctttcaatacctatgttcagttgactcgg
aattacccaaaacaagaagaaattgtttctgatgtggatataagcaatggagtggaatcg
gtacccatttctttctgtaatgaaattgacaatagaaagcttccacattttaagtacaga
aggactgtgtggccacgtgcatattatctaaccagcttttccaacatgtttactgattca
tgtgactgttctgagggctgcatagacataacaaaatgcgcatgtcttcaattgacagca
aggaatgccaagacttgccccttgtcaagtaataaaataaccactggatataaatataaa
agactacagagacaaataccttctggcatttatgaatgcagcctgttgtgcaagtgtaat
agacggatatgtcaaaatcgagttgtccagcatggacctcaagtgaggctacaggtgttc
aaaactgagaaaaagggatggggagtacgctgcctagatgacattgacagagggacattt
gtttgcatttattcaggaagattattaagcagatctaatgtggagaaacctggtgctgct
actgatgaaaacggaaaagattatattatgaaaaatatgttttcaaaaaagaggaaaata
gaagttgcagattgtgaggttgaagttatcccattagacctggaaacacataatagaagt
gctgcgactgaggagtgtccacctgtattcaataataatataaaagagcctgttacagat
atgaaatgtaacagtatttcaagaattcaatatcattcagtcattagaagtcctaaagtg
aagacagtcattattcagcgcaatgggaaaaggatgggatttgcttcctcagagtctgtc
acctcagaagataatgatggatttaaaccaactcaagtacatctgaactccaataccaag
gaaatgaaaaaggattcaagctcctaccaagttaaagactctgaagacaatctgctgatt
gaatcagatgtgatagatataactaaatgtagagaagaatctccatcagggggcagatgt
aaccaagcaaccacactggataaacaaaatattataaaggagttcaaagctcaagtgcaa
aagccccaagaggaaagatctccagcgtatcgaaatcatcaggtcttttgtgataaagag
ttcccaagtgaagccaagaatatttcacctaattccctaaagaagttcagtaaagggaat
gtgtttttattggatgccacaaaagaagggaatgtgggccgcttccttaatcatagttgt
tgcccaaatcttttggtacagaatgtttttgtagaaacacgtgacagaaattttccattg
gtggcgttcttcaccaacaggcatgtgaaagcaagaacagaactaacatgggattatggg
tatgaagctgggactatgcctgaaaaagaaatcctctgccaatgtggggttaacaagtgt
agaaagaaaatattataa

DBGET integrated database retrieval system