KEGG   Canis familiaris (dog): 485544Help
Entry
485544            CDS       T01007                                 

Gene name
LIG4
Definition
(RefSeq) DNA ligase 4 isoform X2
  KO
K10777  DNA ligase 4 [EC:6.5.1.1]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    485544 (LIG4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cfa03400]
    485544 (LIG4)
Enzymes [BR:cfa01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     485544 (LIG4)
DNA repair and recombination proteins [BR:cfa03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     485544 (LIG4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C BRCT DNA_ligase_IV BRCT_2 RNA_ligase mRNA_cap_enzyme LIG3_BRCT
Motif
Other DBs
NCBI-GeneID: 485544
NCBI-ProteinID: XP_005634154
Ensembl: ENSCAFG00000006031
VGNC: 42675
LinkDB All DBs
Position
22
AA seq 844 aa AA seqDB search
MRLILPQLERERMAYGIKETMLAKLYIELLNLPKEGKDALKLLNYRTPTGTRGDAGDFAT
IAYFVLKPRCLQKGSLTIQQVNDILDSIASNNSARKKDLIKKSLLQLITQSSALEQKWLI
RMIVKDLKLGFSEQSVFSAFHNDAAELHNVTTDLEKVCRQLHDPSIGLSDISITLFSAFK
PMLAAIADIERIEKDMKHQSFYIETKLDGERMQMHKDGDVYQYFSRNGYNYTDQFGDSPR
EGSLTPFIHSAFKTDVQICILDGEMMAFNPNTQTFMQKGNKFDIKRMVEDSDLQTCYCVF
DVLMVNNKKLGRETLKKRYEILTSVFTPIPGRIEIVQKTQAHTKKEVIDALNEAIDKREE
GIMIKHPLSIYKPDKRGEGWLKIKPEYVDGLMDELDILIVGGYWGKGSRGGMMSHFLCAV
AEKPPPGEKPSVFHTLCRVGSGYTMKELYDLGLKLAKHWKPFHKKALPSSILCGTEKPEV
YIEPCNSVIVQVKATEIVSSDMYKTGCTLRFPRIEKIREDKEWHECTTVDDLEQLRGKAS
GKLASKHLDIGGDDEPQEKKRKAAPKIKKIIGIIEHLKAPNLSNINKVSNIFEDVEFCVM
SGTDSHPKPDLENRIAEFGGYIVQNPGPDTYCVIAGSENIRVKNIISSNKHDVVKPEWLL
ECFKTKSCVPWQPRFMIHMCPSTKEHFAREYDCYGDSYFVDLDLNQLKEVFSGIKNSSKQ
TPREMASLIADLEYRYSWDRSPLCLFRHCIVYLDLYAVINDLSTKIEGTRLAITALELRF
HGAKVVSCLAQGVSHVIIGEDHSRVAVLKSFRRTLKRKFKILQQDWVTESIDKCELQEEN
QYLV
NT seq 2535 nt NT seq  +upstreamnt  +downstreamnt
atgagacttattcttcctcagctagaaagagagagaatggcctatggaatcaaagaaact
atgcttgctaaactttatatcgaattgcttaatttacctaaagaaggaaaagacgccctt
aaacttttaaattacagaacacccactggaactcgtggagatgctggggactttgcaaca
attgcatattttgtgttgaaaccaagatgtttgcagaaaggaagtttaaccatacagcaa
gtaaatgacattttagactcaattgccagcaataattctgccagaaaaaaggacctgata
aagaaaagtcttcttcagctaataactcagagttcggcactggaacaaaagtggcttata
cggatgattgtaaaagacttaaaacttggttttagtgagcaatctgtattctctgctttc
cataatgatgctgccgagttgcataatgtcactacagatctggaaaaagtctgtaggcaa
ctgcatgatccttccataggactcagtgatatttctatcactttattctctgcctttaaa
cctatgctggctgctatagcagatattgagcgaatagagaaggacatgaaacaccagagt
ttctacattgaaaccaagctagatggtgagcgtatgcaaatgcacaaagacggggatgtg
tatcagtatttctcccgaaatggatataactatacggatcagttcggcgattctccacgg
gaaggttctcttacaccgttcattcacagtgcattcaaaacagatgtacagatctgtatc
ctggatggcgagatgatggccttcaaccctaatacacaaacttttatgcaaaaggggaat
aagtttgatatcaaaagaatggtggaggattctgatctgcaaacctgttactgtgttttt
gatgtactgatggttaataataaaaagctgggacgtgaaacgctgaaaaagaggtatgaa
attcttactagtgtttttacaccaataccaggtagaatagaaatagtgcaaaaaacacaa
gctcatactaagaaagaagtaatcgatgctttgaatgaagcaatagataaaagagaagag
ggaatcatgataaaacatcctctatctatttacaagccagacaaaagaggtgaaggatgg
ttaaaaattaagcctgagtacgtagatgggctgatggatgaactggacatcttaattgtt
gggggctattggggcaaaggttcacgaggtggaatgatgtctcattttttgtgtgctgta
gcagagaagcctcctcctggtgaaaaaccgtcagtgtttcatactctgtgccgtgttggt
tcaggttatactatgaaagaactgtatgatctgggtttaaaattggccaaacattggaag
cctttccataaaaaagctctaccaagcagcattttatgtggaacagagaagccagaggta
tacattgagccttgtaattctgtcattgttcaagttaaggcaacagagattgtctccagt
gatatgtataaaactggctgcacattgcgttttccacggattgaaaagataagggaagac
aaggagtggcatgaatgtactaccgtggatgacttagagcaacttcgagggaaagcgtct
ggaaagcttgcatctaaacaccttgacataggtggtgatgatgaaccacaagaaaagaag
cggaaagctgccccaaagattaagaaaattattggaattatcgagcacttgaaagcaccc
aacctttctaatataaataaggtttctaatatatttgaagatgtggagttttgtgttatg
agtggaacagacagccatccaaagcctgacctggagaacagaattgcagaatttggtggt
tatatagtacaaaacccaggcccagacacgtactgcgtgattgcaggatcggagaacatc
agagtgaaaaacatcatttcttcaaataaacatgatgttgtcaagcctgagtggctgtta
gagtgttttaagaccaaaagctgtgtgccgtggcagcctcgctttatgattcacatgtgc
ccatcgacaaaagaacattttgcccgtgaatatgattgttatggtgacagttattttgtt
gatctagatttgaaccaactgaaggaagtgttctcaggaattaaaaattctagcaaacaa
actccaagagaaatggcttctctgattgctgatttagaatatcggtattcctgggaccgc
tccccactctgtctattccgacattgtattgtttatctggacttgtatgctgttattaat
gacttgagtaccaaaatcgagggaacgagattagcaattacagctttggagcttcgattt
catggagcaaaagtagtttcttgcttagctcagggagtgtctcatgtaatcattggggag
gatcatagtcgtgttgcagttttaaaatcttttcgaagaactcttaagagaaagtttaaa
atcctgcaacaagattgggtaactgagtccatagacaagtgtgagttgcaggaggaaaat
caatatttggtttaa

DBGET integrated database retrieval system