KEGG   Canis familiaris (dog): 485807Help
Entry
485807            CDS       T01007                                 

Gene name
TGM6
Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase 6
  KO
K05624  transglutaminase 6 [EC:2.3.2.13]
Organism
cfa  Canis familiaris (dog)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    485807 (TGM6)
Enzymes [BR:cfa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     485807 (TGM6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core
Motif
Other DBs
NCBI-GeneID: 485807
NCBI-ProteinID: XP_022265195
Ensembl: ENSCAFG00000006727
VGNC: 47319
LinkDB All DBs
Position
24
AA seq 747 aa AA seqDB search
MDTLKDADCLAQQHPEICLVNSGLAGWLLQHADQTVRTPARRGRVRVTEVDWHSRKNGAA
HHTQEYPGPELVVRRGQVFTLRLELSRALEDQETIIFTLETGPQASEDCHTKAVFQISEP
DVGQNWTAVEEAQTENTMTVSITSPPNAVIGRYLMRTRVSSRRKQNDRKLGEFVLLFNPW
CPEDDVFLDSEEERQEYVLNDSGIIFRGVEKHIRAQGWNYGQFEEEILDICLSILDRSPL
HQNDPATDVSHRHDPIYVTRAISAMVNSNNDRGVVQGQWQGKYGGGTSPLHWSGSVAILH
KWFKGRFKPVKYGQCWVFAGVMCTVLRCLGIATRVVSNFNSAHDTDRNLSVDKYVDSFGR
TLEDLTEDSMWNFHVWNESWFARRDLGPSYNGWQVLDATPQEESEGMFRCGPASVTAIRE
GDVHLAHDGPFVFAEVNADYITWLWHEDESRERVYSDTKKIGRCISTKAVGSDSRVDITG
LYKYPEGSRKERQVYRKAVRKLFGVEAPGRRTRVRRAGSRGLWREDLMEPATKPSVTGKF
KMLEPPMLGHDLRLALCLANLTSRAQRVRVNLSGATILYTRRPVAEILHESHTVRLGPEE
EKKIPITISYSQYKEDLTEDKKILLAAMCFVTKGEKLLVEKDITLEDFITIKVLGPAVVG
VAVVVKVTLVNPLLERVEDCVLMVEGSGLLQGQLSIDVPSLEPQEKASVQFSITPSKSGP
RQLQVDLISPHFPDIKGFVVIHVATAK
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atggacaccctcaaggatgctgactgtcttgcccagcagcaccccgagatctgcctcgtg
aactcggggctggctggctggctgctccaacacgccgatcagacggtccgcacacccgcg
cgcagaggaagggtcagagtcaccgaggtggactggcacagccggaaaaatggtgctgcc
caccacacccaggagtaccccggccctgagctggtggttcgcaggggccaggtgttcacc
ttgcggctggagctgagcagagccctggaggaccaggagaccatcatcttcaccttggag
acaggaccccaggcatctgaggactgccacaccaaagctgtgttccagatatcggagccg
gatgtgggccagaactggacagcggtggaggaggctcagacggagaacaccatgaccgtc
agcatcaccagccctcccaacgctgtcattggccgctacctgatgaggaccagggtctcc
tctcgccgaaagcaaaatgaccggaagctgggcgaatttgttctccttttcaacccgtgg
tgcccagaggacgacgtgtttctggactcagaggaggagagacaggagtacgtgctgaac
gacagtgggatcatcttccgaggcgtggagaaacacatccgagcccagggctggaactac
gggcagtttgaggaggagatcctggacatctgcctctccatcctggaccgaagtcctctt
caccaaaatgacccagccaccgacgtgtcccaccgccacgaccccatctatgtcaccagg
gcaatcagcgccatggtgaacagcaacaatgacaggggcgtggttcaaggccagtggcag
ggcaagtacggcggcggcaccagccccctgcactggagcggcagcgtggccattctgcac
aagtggttcaagggcaggttcaagcctgtcaaatacggccagtgctgggtcttcgctgga
gtcatgtgcacagtccttagatgcctggggatcgccacccgagtcgtgtccaactttaac
tcggcccatgacacggacaggaacttgagcgtggacaaatacgtggactccttcgggcgg
accttggaggacctgacagaggacagcatgtggaatttccacgtctggaatgagagttgg
ttcgcccgccgggacctgggcccctcttacaatggttggcaggttctggacgccaccccc
caggaggagagtgaaggcatgttccggtgcggcccagcctccgtcactgccatccgagag
ggcgacgtgcacctggcccacgatggcccctttgtgttcgcggaggtcaatgcagattac
atcacctggctctggcacgaggatgagagccgggagcgggtgtactcggacaccaagaag
attgggaggtgcatcagcaccaaggccgtgggcagtgactcccgcgtggacatcacgggc
ctctacaagtatccagaagggtcccggaaggagaggcaggtgtaccgtaaggccgtgagg
aagctgttcggcgtggaagcccccgggaggaggacccgggtccgcagggcaggcagccgc
gggctgtggcgcgaggacctcatggagcctgccaccaagcccagcgtcaccggcaagttc
aagatgctggagccacccatgctgggccacgacctgagactggctctgtgcttagctaac
ctcacctcccgggcccagagggtccgggtcaacctgagcggtgccaccatcctatacacc
cgcaggccggtggccgagatcctgcacgagtcccacacggtgcgactggggcccgaagaa
gagaaaaagatcccaatcacaatatcttactcgcaatataaggaagacctgacagaggac
aagaagatcctgttggctgccatgtgctttgtcaccaaaggagagaagctcctggtggag
aaggacattactctggaggacttcatcaccatcaaggtgctgggccccgccgtggtgggg
gtggcggttgttgtgaaagtgacgctggtcaaccccctcctggagagagtggaggactgt
gtgctgatggtggagggcagtggccttctccagggacagctcagcatcgacgtgcccagc
ctggagccccaggagaaggcttccgtccagttcagcatcaccccgtccaagagcggcccg
aggcagctgcaggtggatctcatcagcccccacttcccagacatcaaaggctttgtggtc
atccacgtggccaccgccaagtga

DBGET integrated database retrieval system