KEGG   Canis familiaris (dog): 485867Help
Entry
485867            CDS       T01007                                 

Gene name
TGM2
Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase 2
  KO
K05625  transglutaminase 2 [EC:2.3.2.13]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa05016  Huntington's disease
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    485867 (TGM2)
Enzymes [BR:cfa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     485867 (TGM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core A2M_N
Motif
Other DBs
NCBI-GeneID: 485867
NCBI-ProteinID: XP_542991
Ensembl: ENSCAFG00000008869
VGNC: 47316
UniProt: F1Q435
LinkDB All DBs
Position
24
AA seq 687 aa AA seqDB search
MAEDLVLEKCDLELEANGRDHHTAGLCQGRLVVRRGQPFWLTLHFTGRSYESSVDSLTFS
AVTGPDPSEEAGTKARFSLSSAVEEGAWTAVVMDQQDSVLSLQLSTPPNAPVGLYRLSLE
ASTGYQGSSFVLGHFTLLFNSWCPADAVYLDSDEERREYVLSQQGFIYQGSVKFIKSIPW
NFGQFEDGILDICLMLLDRNPKFLKDACRDCSSRSNPIYVGRVVSAMVNCNDDQGVLLGR
WDNNYKDGISPMFWIGSVDILRRWKTSGCQRVKYGQCWVFAAVACTVLRCLGIPTRVVTN
FNSAHDQNSNLLIEYVYNKFGEIQKEKSEMIWNYHCWVESWMSRPDLQPGYEGWQALDPT
PQEKSEGTYCCGPVPVRAIKEGDLSTKYDAAFVFAEVNADVVNWIQQDDGSLCKSTNNSQ
TVGMKISTKSVGRDEREDITHNYKYPEGSPEEREAFRKANHLNKLTEKEETGLAMRIRVS
ESMSMGSDFDVFAYINNNTSESHSCRLLLHARTVSYNGILGPECGTKDLLNLSLEPFSEK
SIPLRILYEKYCECLTESNLIKVRGLLVEQAANNYLLAERDIYLENPEIKIRILGEPKQN
RKLVAEASLRNPLTVPLLGCSFTMEGAGLTEEQKVMDVPDPVEAGEEVKVRVDLLPRHVG
RHKLVVNFESDKLKAVKGFRNVLIGPA
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atggccgaggatctggttctcgagaaatgtgacctggagctggaagccaatggccgtgac
caccacacggctggcctgtgccaggggaggctggtggtgcggcggggccagcccttctgg
ctgaccctgcacttcaccggccgcagctatgagtccagtgtggacagcctcaccttcagc
gccgtgacgggcccagaccccagcgaggaggccgggaccaaggcccgcttctccctgtcc
agtgctgtggaggagggtgcctggacggccgtggtgatggaccagcaggacagcgtcctc
tcgctgcagctcagcaccccgcctaacgccccggtcggcctgtaccgcctcagcctggag
gcctccaccggctaccagggctccagcttcgtgctgggccacttcactctgctcttcaac
agctggtgcccagcggatgctgtgtacctggactcagatgaggagcggcgggagtacgtg
ctcagccagcagggcttcatctaccagggttcagtcaagttcatcaaaagcatcccttgg
aactttgggcagtttgaagatggaatcctggacatctgcttgatgctcctggacaggaac
cccaagttcctgaaggatgcctgccgtgactgctccagccgcagcaatcctatctatgtg
ggccgggtggtgagcgccatggtcaactgcaatgatgaccagggtgtgctgctgggacgc
tgggacaacaattataaggacggcattagccccatgttctggatcggcagcgtggacatc
ctgcggcgctggaagacctctggctgccagcgtgtcaagtatggccagtgctgggtcttc
gctgctgtggcctgcacagtgctgcggtgcctcggcatccccacccgagtggtgaccaac
tttaactcggcgcatgaccagaacagcaacctgctcatcgagtatgtctacaacaagttt
ggggagatccagaaggagaaaagcgagatgatctggaactaccactgctgggtggagtca
tggatgagcaggccggacctgcagcctggctatgaggggtggcaggccctggaccccacg
ccccaggagaagagcgaagggacatactgctgtggcccggtcccggtgcgtgccatcaag
gagggtgatctgagtaccaagtacgacgcggcttttgtcttcgccgaggtcaacgccgac
gtggtgaactggatccagcaggacgatgggtccttgtgcaagtccaccaacaactcccag
accgtggggatgaagatcagcactaagagcgtgggccgtgatgagcgggaggacatcacc
cacaactacaagtacccggaggggtccccagaggagagagaagccttcagaaaggccaac
cacctgaacaagctgactgaaaaagaggagaccgggttggccatgcggatccgcgtgagc
gagagcatgagcatgggcagtgactttgacgtctttgcctacatcaacaacaacacgtcc
gagagccactcctgccgcctcctgctccatgcccgcaccgtcagctacaacgggatcctg
gggcccgagtgtggcaccaaggacctgctcaatctttccctggagcccttttccgagaag
agcatcccccttcgaatcctctatgagaagtactgtgagtgtctgacagagtcgaacctc
atcaaggtgcggggcctcctcgtggaacaagccgccaacaactacctgctggccgagagg
gacatctatctggagaatccagaaatcaagatccggatcctgggagagcccaagcagaac
cgcaagctggtggctgaggcgtccctgcggaaccccctcaccgtgcccctgttaggctgc
agcttcaccatggaaggggccggcctcactgaggagcagaaggtcatggacgtcccggac
cccgtggaggcgggggaggaggtcaaggtgagagtggacctgctgccacgccacgtgggc
cgccataagctggtggtgaactttgagagcgacaagctaaaggctgtgaaaggcttcagg
aatgtcctcattggtcccgcctaa

DBGET integrated database retrieval system