KEGG   Canis familiaris (dog): 486224Help
Entry
486224            CDS       T01007                                 

Gene name
GALNT9
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 9
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00512  Mucin type O-glycan biosynthesis
cfa01100  Metabolic pathways
Module
cfa_M00056  O-glycan biosynthesis, mucin type core
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    486224 (GALNT9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:cfa01003]
    486224 (GALNT9)
Enzymes [BR:cfa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     486224 (GALNT9)
Glycosyltransferases [BR:cfa01003]
 O-Glycan biosynthesis
  Mucin-type
   486224 (GALNT9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_tranf_2_3 Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 486224
NCBI-ProteinID: XP_005636560
Ensembl: ENSCAFG00000006281
VGNC: 41097
LinkDB All DBs
Position
26
AA seq 631 aa AA seqDB search
MAVARKIKTLLTVNILVFVGIILFSVYCRLQDRSEGLVQIVRSADGRMRSRHTRVGALVD
REAILQRLDHLEEVVYNQLNGLAKPIGLVEGPGGLGQGGMAATLREDSLETESKYEEYGY
NAQLSGRISLDRTIPDYRPKKCRQMTHATDLPQISVVFIFVNEALSVILRSVHSVVNRTP
SWLLKEVILVDDNSDSVELKASLDQYVNRRYPGLVKIVRNNRREGLIRARLQGWKVATAP
VVGFFDAHVEFGMGWAEPALMRIQEDRRRIVLPAIDNIKYDTFEVQQYASAVLEAHRLTL
VFVSLLKAKQCIWGIPSPGLSQPPAPPAGRGSGYRTCDLLRAVSAPTRTPAMIGCSFVVD
REYFGDIGLLDPGMEVYGGENIELGMRVWQCGGSMEVLPCSRVAHIERSKKPYNNDIDYY
AKRNALRAAEVWMDSFKSHVYMAWNIPMTNPGVDFGDVSERLALRQRLKCRSFKWYLENV
YPEMRTYNDTLTYGEVRNSKASGYCLDQGAEDDDHAILYPCHGMSSQLVRYSTEGLLQLG
PLGSTAFLPDSKCLVDEGRSRTPALKKCEDVARPAQRLWDFTQSGPIVSRDTGRCLEVEM
SKDANFGLRLVVQRCSGQKWTIRNWIKHGRH
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atggcggttgccaggaagatcaaaactttgctgacggtcaacatcctggtgttcgtgggc
atcatcctcttctccgtgtactgccgcctgcaggaccgctccgaggggctggtacagatc
gtgcgcagcgccgacggccggatgcgcagccggcacaccagggtgggcgcgctggtggac
cgcgaagccatcctacagcgcctggaccacctggaggaggtggtctacaaccagctgaat
ggcctcgccaagcccatcggcctggtggagggaccagggggcctgggccagggcggcatg
gcggccaccctgcgcgaggacagcctggagacagagagcaagtacgaggaatacgggtac
aatgcacagctcagcggtcgcatctccctggacaggaccatcccggactacaggccaaaa
aagtgcagacagatgacccatgccaccgacctgccccagatctctgtggtgttcatcttt
gtcaacgaggccctgtctgtcatcctgcgctctgtgcacagtgtggtcaaccgcacaccc
tcgtggctgctcaaggaggtcatcctggtggacgacaacagtgacagtgtggaactcaag
gccagcctggaccagtatgttaacaggaggtacccaggcctggtgaagatcgtccgcaac
aacaggcgggaaggcttgatccgggcgcggctgcagggctggaaggtggccacggcccca
gtggtcggattcttcgatgcccacgtggagttcggcatgggctgggctgagcccgcgctc
atgcggatccaggaggaccgccggcgcatcgtcctgccggccattgacaacatcaagtac
gacacgttcgaagtgcagcagtacgccagcgcggtgctggaagcacaccggctcaccttg
gtgtttgtcagtctcctgaaggccaagcagtgcatctggggcatcccaagtcctgggctc
tcccagccaccagcacccccagcaggtcggggctcagggtaccgtacctgtgacctgctc
agggctgtctctgcccccaccaggacccccgccatgatcggctgttcattcgttgtggac
cgggagtacttcggggacatcgggctgctagacccaggcatggaggtgtacggtggtgag
aacattgagctgggcatgagggtgtggcagtgcggcggcagcatggaggtgctgccctgc
tcccgcgtggctcacatcgagcgttccaagaagccctacaacaatgacatcgactactac
gccaagcgcaacgccctgcgggcagccgaggtgtggatggacagcttcaagtcccacgtg
tacatggcctggaacatccccatgaccaacccaggggtggactttggggacgtgtctgaa
cggctggccctacggcagcgcctgaaatgccgcagctttaagtggtacctggagaacgtg
tacccggagatgaggacctacaacgacaccctcacgtacggagaggtgagaaacagcaaa
gccagcggctactgcctggaccagggagcagaagacgatgaccacgcaatcctctatccg
tgccacgggatgtcctcccagctggtgcggtacagcacagagggcctgctgcagctgggg
ccgctgggctccactgctttcctgccggactccaagtgcctggtggatgagggcaggagc
cgcacgcccgccctgaagaagtgcgaggatgtggcccggcctgcgcagcggctgtgggac
ttcacccagagtggccccatcgtgagccgagacactggcaggtgcctggaggtggagatg
tccaaggacgccaacttcgggcttcggctggtggtgcagaggtgttcagggcagaagtgg
accattagaaattggatcaagcatgggcggcactga

DBGET integrated database retrieval system