KEGG   Canis familiaris (dog): 486257Help
Entry
486257            CDS       T01007                                 

Gene name
SETD1B
Definition
(RefSeq) histone-lysine N-methyltransferase SETD1B
  KO
K11422  histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    486257 (SETD1B)
Enzymes [BR:cfa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     486257 (SETD1B)
Chromosome and associated proteins [BR:cfa03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     486257 (SETD1B)
   HMT complexes
    COMPASS/SET1 complex
     486257 (SETD1B)
    COMPASS/SET1 complex (yeast)
     486257 (SETD1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: N-SET SET RRM_1 RRM_5
Motif
Other DBs
NCBI-GeneID: 486257
NCBI-ProteinID: XP_005636236
Ensembl: ENSCAFG00000008167
VGNC: 46053
LinkDB All DBs
Position
26
AA seq 1972 aa AA seqDB search
MENSHPPHHHHQQPPPQPGPSGERRNHHWRSYKLMIDPALKKGHHKLYRYDGQHFSLAMS
SNRPVEIVEDPRVVGIWTKNKELELSVPKFKIDEFYVGPVPPKQVTFAKLNDNIRENFLR
DMCKKYGEVEEVEILYNPKTKKHLGIAKVVFATVRGAKEAVQHLHSTSVMGNIIHVELDT
KGETRMRFYELLVTGRYTPQTLPVGELDAVSPIVNETLQLSDALKRLKDGSLSAGCGSGS
SSVTPNSGGTPFSQDTAYSSCRLDTPNSYGQGTPLTPRLGTPFSQDSSYSSRQPTPSYLF
SQDPTVTFKTRRHESKFTDAYNRRHEHHYVHNSCAVTTVAGAPTAFRGSVDLSFGAVSSS
GGNSGPPFKAQPQDSATFAHTPPPAQATPTSGVTFKSTFSPYQTPVPPFPPPPEEPTTTT
TFGARDSGDFRRAPVPPPLPPTEPLTKEKPGTPPGPPPPDANSMELGGRPTFGWSPEPCD
SPGTPTLESSPAGLEKPHDSLDSRIEMLLKEQRTKLPFLREQDSDTELQMEGSPISSSSS
QLSPLAPFGTNSQPGFRGPTPPSSRPSSTGLEDISPTPLPDSDEDDELDLGSGPRPPPEP
GPPDPSGLLGQTTEVALDLAGDRTPTSEKMDEGQQSSGEDMEISDDEMPSAPITSADCPK
PMVVTPGAAAVAAPSVLAPTLPLPPPPGFPPLPPPPTPPPPQPGFPMPPPLPPPPPPPPP
AHPAVTVPPPPLPAPPPGVPPPPILPPLPPFPPGLFPVMQVDMSHVLGGQWGGMPMSFQM
QTQMLSRLMTGQGACPYPPFVAAAAAAASAGLQFVNLPPYRGPFSLSNSGPGRGQPWPPL
PKFDPSVPPPGYVPRQEDPHKATVDGVLLVVLKELKAIMKRDLNRKMVEVVAFRAFDEWW
DKKERMAKASLTPVKSGEHKDEDRPKPKDRIASCLLESWGKGEGLGYEGLGLGIGLRGAI
RLPSFKVKRKEPPDTASAGDQKRLRPSTSVDEEDEESERERDRDMADAPCELTKRDPKGV
GVRRRPARPLELDSGGEEDEKESLSVSSSSSASSSSGSSTTSPSSSASDKEERESTEEEE
EGEEEEEEEEEEEEEEGPRSQVSSSSTSSTSDKDDDDDDDEDSEDQDESENDDEDVALSE
ASEKEEVDSDGEETVSIPTSKAGAGSSSESSESSEFESSSESSSSSSEDEEELERRKEEE
EEEEEEAAADESMAPVVPDEDFEENVATGAPVTESSVMEEEVDIEAEDEAPEERTPVPEE
PSLPVCVEELASCKEPPEEPGLKEEGAKLLSPEPPAGEVEARPPPSPECTPEDDLEVEPP
PLLSLPLQPPLPPPRPPRPPSPPPEPDTPDPAHPPAPLEPPPEEQPPRTPGLCGSLAKSQ
STEMVPATPSGEPPLSGGSSGLSLSSPQVPGSPFSYPSQSPSLSSGGLPRTPGRDFSFTP
TFPEPGGPLLLPVCPLPAGRRDERSGPLASPVLLETGLPLPLPLPLPLPLALPVPVLRAQ
TRAPAQLPPLLPAPLTPCPPPIKRKPGRPRRSPPAVLSLDGPLVRPPAGAALGRDLLLLP
GQPQTPVFPSTHDPRAVTLDFRNAGIPAPPPPLPPQPPPPPPPPPVEPTKLPFKELENQW
PSEAIPPGPRGRDDVTEEFMDLAKVRGPWRRPPKKRHEDLVAPASPELSPPQPLFRPRSE
FEEMTILYDIWNGGIDEEDIRFLCVTYERLLQQDNGMDWLNDTLWVYHPSTSLSSAKKKK
RDDGIREHVTGCARSEGFYTIDKKDKLRYLNSSRASTDEPPADTQGMSIPAQPHASTRAG
SERRSEQRRLLSSFTGSCDSDLLKFNQLKFRKKKLKFCKSHIHDWGLFAMEPIAADEMVI
EYVGQNIRQVIADMREKRYEDEGIGSSYMFRVDHDTIIDATKCGNFARFINHSCNPNCYA
KVITVESQKKIVIYSNQHINVNEEITYDYKFPIEDVKIPCLCGSENCRGTLN
NT seq 5919 nt NT seq  +upstreamnt  +downstreamnt
atggagaacagtcaccccccccaccaccaccaccagcagcccccgccgcagcccggccct
tcgggcgagaggaggaaccaccattggagaagttacaagttgatgattgacccggctctg
aaaaagggacatcataaactgtaccgctacgatgggcagcatttcagcctggcgatgtcc
agcaaccgcccggtggaaattgtcgaagatccccgggtcgttgggatctggaccaaaaac
aaggagctggagttgtcggtgcccaaattcaagatcgatgagttctacgtgggcccggtg
cctccaaagcaggtgacgtttgccaagctaaatgataacatccgagaaaacttcctgagg
gacatgtgcaagaagtatggagaggtggaggaggtggagattttgtacaaccctaagacc
aagaagcacttgggcattgccaaggtggtctttgccacggtcaggggagccaaggaggca
gttcagcacctgcatagcacttctgtcatgggcaatatcatccacgtggagctggacacc
aaaggggaaacccgcatgcggttctacgaactgttggtcacgggccgatacacaccccag
accctcccagtgggtgagctggatgctgtctctccaatcgtgaatgaaaccctgcagctg
tcagatgctctgaagcgcctcaaggatggtagcctgtctgcgggctgtggctctggctca
tcctctgtcacccccaatagcggagggacccccttctcccaggacaccgcgtactctagc
tgccgcctagacacacccaactcctacggacagggcacgccactcacgccgcgcctgggc
acccccttctcgcaggactccagctactccagccgtcagcccacaccctcctacctcttc
agccaggaccccacagtgaccttcaagaccaggcgtcacgaaagcaagttcacagatgcc
tacaaccgccgccacgagcatcattacgtccataactcctgtgcggtcaccacagtggca
ggggcccccacagccttcaggggctccgtggacctctcatttggggcagtgagcagcagt
ggaggcaacagtggccctccattcaaggcccaaccacaggactcggccacattcgcccac
actccgccacctgcccaagcaacccccacttctggagtcaccttcaagtcgaccttctct
ccatatcagacccctgtgccccctttccccccaccgcccgaggagcccaccaccacgacc
acctttggggcccgcgacagtggggatttcaggagagcacctgtgccaccacccctgcca
cccaccgaacccctgaccaaggagaagccgggcacaccacctgggccaccacctcccgat
gccaacagcatggagttgggtggccggcccaccttcggctggagtcctgaaccctgcgac
agtccaggcacgcctacgctggaatcatccccggctgggctggagaagccccatgatagc
ttggactcccgcatcgagatgctgctgaaggaacagcgcaccaagctgcccttccttcgg
gagcaggactcggatacagagctgcagatggagggcagccctatctcctcctcctcctcc
cagctttccccactggccccctttggcaccaactcccagccaggctttcgaggccccaca
ccaccatcctcacgcccctccagcactggcctggaggatatcagccccacgccactgcct
gactcagatgaggatgatgagcttgacctgggctcagggccccggccccctccggaacca
ggccccccggacccttctggtcttctgggccagacaactgaggtagccttggacctggct
ggagacaggaccccaacctcagagaagatggatgagggtcagcagtcctcaggcgaggac
atggagatctcggatgatgagatgccctcagcccccatcaccagcgccgactgccccaaa
cccatggtggtgaccccaggggcggcggctgtggcagccccctccgtgctggccccaacc
ctgccgctgcccccgccccctggcttcccaccactgcccccacccccgacaccaccccca
ccacagccaggcttccccatgcccccacctttgccaccacccccacccccaccaccccca
gcccacccggctgtgacagtgcccccccctccactcccagcgcccccgcctggtgtccca
cccccacccatcctgccaccgctgccacccttccccccagggctgtttcccgtgatgcag
gtggacatgagccacgtgctgggtggccagtggggcggcatgcccatgtccttccagatg
caaacgcagatgctgagccgtctgatgactggccagggcgcttgcccctacccacccttt
gtggcagctgcggcagcggcagcctcagctgggctgcagtttgtcaacctgccgccctac
cggggcccgttctccctgagcaacagcggaccaggccgcgggcagccctggccacccctc
cccaagtttgacccatcggtgccgccaccaggctatgtgccacgccaggaggacccacac
aaggccactgtagatggcgtcttgctggtggtgctcaaagagctcaaagccatcatgaag
cgtgacctgaaccgcaagatggtggaggtagtggccttccgggccttcgacgagtggtgg
gacaagaaagagcggatggccaaggcctcactgaccccggtgaagtcaggcgagcacaag
gatgaggacaggccaaagcccaaggaccgcatcgcctcgtgcctgctggagtcgtggggc
aagggtgagggcctgggctatgaaggccttggcctgggcatagggctacgtggggccatc
cgcctgccctccttcaaggtcaaaaggaaagagccaccagacacagcctctgctggtgac
cagaagcgcctgcggccctcaacctctgtggatgaggaagatgaagagtcagagcgtgaa
cgggaccgggacatggcggacgccccttgcgagctcaccaagcgggaccccaagggagtg
ggcgtgcggcgaaggccagcccggccgctggagctggacagtggtggggaggaggacgag
aaggagtcactgtcagtgtcctcatcgtcatcggcatcctcgtcctcgggttcctccacg
acctcaccctcgtcctctgcctccgacaaggaggagcgggaaagcactgaggaggaagag
gagggggaggaggaagaggaagaggaggaggaagaggaggaggaggaaggccccagaagc
caggtctcctcctcctcaacctcatctacgtcagataaggatgacgatgacgatgacgat
gaagatagtgaggaccaggatgagtctgagaatgacgatgaggatgtagccctgtcggag
gcgagtgagaaggaagaagtggactcagatggagaggagactgtaagcatccccacctcc
aaggctggagctgggtcctccagcgagagttctgagtcttctgagttcgaatcaagctcc
gaatcctcctcatcgtcctcagaggatgaagaggagctggagcgaaggaaagaggaggag
gaagaggaagaggaagaggcagcagcagatgaaagtatggctcctgtggttcctgacgag
gactttgaggagaatgtggccacgggggcacctgtaacggagtcctcggtcatggaagag
gaagtggacatcgaggctgaggatgaagctcccgaggagaggacccccgtgccggaagag
ccctccttgcctgtgtgtgttgaggagctggctagctgcaaggagccccccgaggagcca
ggcctgaaggaggaaggggccaagttgctgtctccagaaccccctgctggagaggtggag
gcccgacccccgccttccccagagtgcaccccagaggatgacctggaagtggagccccct
ccgctgctctccttacccctgcagccgccactaccaccccctcgaccaccccggccgccg
agcccaccaccagagcccgataccccagaccctgcacatccacctgcccctctggagccc
cctccggaggagcagcccccgcgtactcccggcctctgtggcagcctggccaaatcacag
agcacagagatggtgccagccacaccgagtggggagcccccactgtcagggggcagcagc
ggtctgtccctgagttccccacaggtgcctggcagccccttctcctacccatcgcagtcc
cccagcttgagtagcgggggtctcccgaggacacctggtcgggacttcagcttcacaccc
accttccctgagcctggtgggcccctgctcctgcctgtctgtcccctcccagctggccga
cgtgatgagcggtctggccccctggcctccccggtgctcctggagacaggcctgcctctc
cccctgcctttgcccctgcccctgcccctggccttgcccgtacctgtcctgcgggcccag
acacgggcccctgcccagctgccacctctgctgccagcaccgctgaccccctgcccaccc
cccatcaagaggaagccgggcaggccccggcggtccccgccggctgtgctctccttggat
gggcccttggtccggccaccggcgggggctgcccttggcagggacctcctcctcctgcca
ggtcagccacagacccctgtctttcccagtacccatgacccccgggccgtaaccctggac
ttccggaacgcggggatcccagcacccccaccacctctgcccccccagcctcctccaccc
ccacctccaccccctgttgagcccaccaagctgccctttaaggagctagagaaccagtgg
ccctccgaggccatccctccaggccctcgcgggcgtgatgatgtcactgaggagttcatg
gacctggccaaggttcgggggccctggcgccggccgcctaagaagcgccacgaggacctg
gtggccccagcctcacctgaactctcgccaccacaacccctcttccggccccggtccgag
tttgaggagatgaccattctgtatgacatctggaatggtggcatcgacgaggaggacatc
cgcttcctgtgtgtcacctacgagcggctgctgcagcaggacaacggcatggactggctc
aatgacaccctctgggtctaccatccctccaccagcctctcttcagctaagaaaaagaaa
cgggatgatggcatccgtgagcacgtgacgggctgtgcccgcagtgagggcttctatacc
atcgacaagaaggacaagctcagatacctcaacagcagccgcgccagcaccgacgaaccc
ccagcagacacccagggcatgagcatccccgcgcagcctcacgcctccactcgggccggc
tcagagcggcgttccgagcagcgccgtctgttgtcctctttcactggcagctgtgacagt
gacctgctcaagttcaaccagctcaagttccggaagaagaagctcaaattctgcaagagc
cacattcacgactggggcctgttcgccatggagcccattgcagctgacgagatggtcatt
gaatacgtgggtcagaacatccgccaggtgatcgcggacatgcgagagaagcgttatgag
gacgagggcattggcagcagctacatgttccgggtggaccatgacaccatcatcgatgcc
accaagtgcggcaactttgcacgcttcattaaccacagctgcaatcccaactgctatgcc
aaggtgatcacagtggagtcgcagaagaagatcgtcatctactcgaatcagcacatcaac
gtcaatgaggagatcacctatgactacaagttccctatcgaggacgtcaagatcccctgc
ctgtgcggctctgagaactgccgggggaccctcaactag

DBGET integrated database retrieval system