KEGG   Canis familiaris (dog): 486589Help
Entry
486589            CDS       T01007                                 

Gene name
HDAC7
Definition
(RefSeq) histone deacetylase 7
  KO
K11408  histone deacetylase 7 [EC:3.5.1.98]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa05034  Alcoholism
cfa05165  Human papillomavirus infection
cfa05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09160 Human Diseases
  09161 Cancers: Overview
   05203 Viral carcinogenesis
    486589 (HDAC7)
  09165 Substance dependence
   05034 Alcoholism
    486589 (HDAC7)
  09172 Infectious diseases: Viral
   05165 Human papillomavirus infection
    486589 (HDAC7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cfa03036]
    486589 (HDAC7)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     486589 (HDAC7)
Chromosome and associated proteins [BR:cfa03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     486589 (HDAC7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 486589
NCBI-ProteinID: XP_013964038
Ensembl: ENSCAFG00000009152
VGNC: 49112
UniProt: F1PK81
LinkDB All DBs
Position
27
AA seq 951 aa AA seqDB search
MDLRVGQRPPVEPPPEPALLALQHPQRLHHHLFFAGLQQRSAEPMRLPMDTPGPQLQVGR
QDQELRQLLNKDKSKRSAVASSVVKQKLAEVILKKQQAALERTVHPSSPSIPYRTLEPLE
TEGAARSMLSSFLPPVPSLPNDPPEHFPLRKTVSEPNLKLRYKPKKSLERRKNPLLRKES
APPSLRRRPAETLGDSSPSSSSTPASGCSSPNDSEHGPNPVLGSEALLGQRLRLQETSLA
PFALPTVSLLPAITLGLPAPARADADRRTHPTLGPRGPVLGGPHAPLFLPHGLEPEAGGA
LPSRLQPILLLDPSVSHTPLLTVPGLGPLPFHFAQSLLTTERLSGSGLHRPLSRTRSEPL
PPSATAPPPLGPLQPRLDRLKPHIQLIKRPAKPSEKPRLRQIPSAEDLETDGGGVVSVGD
DGLEHRESSHGQHDTRGPAALQQHQQVFLWEQQRLAGRLPRGGTGDSVLLPLAQGSHRPL
SRAQSSPAAPASLPTPEPASQARVLPSSETPARTLPFTTGLVYDSVMLKHQCSCGDNSRH
PEHAGRIQSIWSRLQERGLRSQCECLRGRKASLEELQSVHSERHVLLYGTNPLSRLKLDN
GKLAGLLAQRMFVMLPCGGVGVDTDTIWNELHSSNAARWAAGSVTDLAFKVASRELKNGF
AVVRPPGHHADHSTAMGFCFFNSVAIACRQLQQQGKASKILIMDWDVHHGNGTQQTFYQD
PSVLYISLHRHDDGNFFPGSGAVDEVGAGSGEGFNVNVAWAGGLDPPMGDPEYLAAFRMV
VMPIAREFSPDLVLVSAGFDAAEGHPAPLGGYHVSAKCFGYMTQQLMSLAGGAVVLALEG
GHDLTAICDASEACVAALLGNKVDPLSEEGWKQKPNLNAIRSLEAVIRVHSKYWGCMQRL
ASCPDSWVPRVPGADTEEVEAVTALASLSVGILAEERPPEQLVEEEEPMNL
NT seq 2856 nt NT seq  +upstreamnt  +downstreamnt
atggacctgcgggtgggccagcggcccccggtggagcccccgcccgagcccgcgttgttg
gccctgcagcatccccagcgcctgcaccaccacctgttcttcgcaggcctgcagcagcgc
tcagcggagcccatgaggctccccatggacacgccggggccccagctgcaggtggggcgg
caggaccaagagctgcggcagcttctcaataaagacaagagcaagcgaagtgccgtagcc
agcagcgtggtcaagcagaagctggcagaggtgattcttaagaaacagcaggcagcccta
gagagaacagtccatcccagtagccccagcattccctacagaactctcgagcccttggag
acggaaggagctgctcgctctatgctcagcagctttctgcctcctgtgcccagcctcccc
aatgaccccccggagcacttccctctccgaaagacagtctctgagcccaacctgaagctg
cgctacaagcccaagaagtccctggaacggaggaagaatccgctgctcagaaaggagagc
gccccgcccagtctccggcggcggcccgcagagaccctgggtgactcctccccgagcagc
agcagcacgccagcgtcaggctgcagttcccctaatgacagcgagcatggccccaacccc
gtcctgggctccgaggcgctcttgggccagcggctgcggctgcaggagacctctctggcc
ccgttcgccttgccgacagtgtccttgctgcccgcaatcacgctggggctgcccgcccct
gccagggctgatgctgaccgcaggacccatccgactctgggccctcgggggccggtcctg
gggggcccccatgctcccctcttcctgccccatggcttggagcccgaggctgggggcgcc
ttgccctctcgactgcagcccattctcctcttggatccctccgtttctcacacccctctg
ctgacggtgcccgggcttgggcccctgcccttccactttgcccagtccctactgaccacc
gagcggctctctgggtcgggcctccaccggccactaagccggacccgctcagagcccctg
cccccaagcgccaccgcccccccaccgctgggccccctgcagccccgcctggaccggctc
aaaccgcacatccagctgatcaagaggccagccaagccaagtgagaagccccgactgcgg
cagataccctccgctgaggacctggagacagatggtgggggagtggtgtcagtgggggat
gacggcctggaacacagggagtcaagccatgggcagcacgacaccagaggcccggctgct
ctccagcagcaccagcaggtgttcctgtgggagcagcagcgactggctggacggctcccc
cgggggggaactggggactctgtgctgcttcccctggcccagggcagtcaccggcccttg
tccagggctcagtcgtccccggctgcgcctgcctccctgccgactccagagcccgccagt
caggcccgtgtcctgcccagctcagaaacacctgccaggaccctgccgttcaccacaggg
ttggtctacgactcggtgatgctgaagcaccagtgttcctgcggggacaacagcaggcac
ccggagcacgcgggccgcatccagagcatctggtcccggctgcaggagcggggcctccgg
agccagtgcgagtgtctccggggccggaaggcctccctggaggagctgcagtcggtgcac
tcggagcggcacgtgctcctctacggcaccaacccgctcagtcgcctcaaactggacaac
gggaagctggcagggctcctggcacagcggatgtttgtgatgctgccgtgtggtggggta
ggggtggataccgataccatttggaatgagctgcactcctccaacgcagcccgctgggcc
gccggcagcgtcaccgacctcgccttcaaagtagcttcccgtgagctaaagaatggtttt
gctgtggttcggcccccaggacaccatgcagaccattccacggccatgggcttctgcttc
ttcaactccgtggccatcgcctgccggcagcttcaacaacagggcaaggccagcaagatc
cttatcatggactgggacgttcaccacggcaacggcacccagcagaccttctaccaagac
cccagtgtgctctacatctccctgcatcgccatgatgatggcaacttcttccccggcagc
ggggccgtggatgaggtgggagcgggtagtggtgagggcttcaatgtcaacgtggcctgg
gcaggaggtctggaccccccgatgggggatcctgagtacctggccgccttcaggatggtc
gtgatgcccatcgcccgagagttctctccggacctggtcctggtgtcagctgggttcgat
gctgccgagggtcacccagccccactgggtggctaccatgtttccgctaagtgttttggg
tacatgacgcagcagctgatgagcttggcgggcggtgcggtggtgctggccttggaaggt
ggccacgacctcacagccatctgtgacgcttctgaggcctgtgtggctgctcttctgggc
aacaaggtggatcccctctcagaagagggctggaaacagaaacccaacctcaacgccatc
cgctctttggaagccgtgatccgggtgcacagtaaatactggggctgcatgcagcgcctg
gcttcctgtccagactcctgggtgcccagggtgccaggggccgacacagaagaagtggag
gcagtgaccgcactggcatccctgtccgtgggcatcctggctgaagagcggcccccggaa
cagctggtggaggaggaagagcctatgaatctctaa

DBGET integrated database retrieval system