KEGG   Canis familiaris (dog): 487517Help
Entry
487517            CDS       T01007                                 

Gene name
GANC
Definition
(RefSeq) neutral alpha-glucosidase C isoform X1
  KO
K12317  neutral alpha-glucosidase C [EC:3.2.1.20]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00052  Galactose metabolism
cfa00500  Starch and sucrose metabolism
cfa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    487517 (GANC)
   00500 Starch and sucrose metabolism
    487517 (GANC)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     487517 (GANC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 487517
NCBI-ProteinID: XP_005638355
Ensembl: ENSCAFG00000010104
VGNC: 41107
LinkDB All DBs
Position
30
AA seq 980 aa AA seqDB search
MFTNSHLRFGRLRRRPALKGSGDQASSQCSVWLSPLVRPSLSSLLSQSQTRGPEVWGSLL
KMKLWIKTFSKTAARLLSTGVFIGCISGNGIAASKNKRQKHQLSRRSTYQALLDSVTTGK
DSTKFHIINETTKVPLLAEVYGIEGNIFRLKINEETPLKPRYEVPDVLTIKPSTVRLISC
SGDAGSLVLADGKGDLKCHITANPFKIDLVSEEEIVMSINSLDQLYFEHLQIPLKQRSTK
ENKEDTSVDASQEDQEDLGLWEEKFGKFVDVKVNGPASIGLDFSLHGFEHLYGIPQHAES
HQLKNTSDGDAYRLYNLDVYGYKIHDKMGIYGSVPYLLAHKLGRTLGIFWLNASETLVEI
NTEPAVKYTLTQMGPVAAKQKIRCRTDVHWMSESGIIDVFLLTGPTPSDIFKQYSYLTGT
QAMPPLFSLGYHQCRWNYEDEQDVKAVDAGFDEHDIPYDVMWLDIEHTEGKRYFTWDKKR
FPNPKRMQELLRSKKRKLVVISDPHIKIDPDYSVYSKAKEQGFFVRNHEGGDFEGVCWPG
LSSYLDFTNPKVREWYSGLFTFSAYQGSTDILYIWNDMNEPSVFRGPELTMQKNAVHHGN
WEHRELHNIYGFYQHMATAEGLIQRSEGKERPFVLTRSFFAGSQKYGAVWTGDNTAEWSY
LKISIPMLLTLSITGISFCGADVGGFIGNPEAELLVRWYQAGAYQPFFRGHATMKTKRRE
PWLFGEEYTRLIREAIRQRYALLPYWYFLFYCAHVAAEPVMRPLWIEFPEELDTFGVEDE
YMLGSALLVHPVTEPKATTVDVFLPGSNEVWYDSKTFAHWEGACTVKIPVALDTIPVFQR
GGSIVPIKTTIGKSTGYMSDSPYGLRVALSTKGSAMGEFYLDDGHSFQYLHQKQFLHRKF
SFLAGVLINSCADKRGHYPTKCVVEQIFIQGLKKQPSSVTTHSSDGKEEPVAFTYCAKMS
TLRLEKLSLNIGTDWEVHIR
NT seq 2943 nt NT seq  +upstreamnt  +downstreamnt
atgttcaccaacagccacctgcgcttcggtcggctccgccgtcgcccggcccttaaaggg
tctggggaccaagcaagctcccaatgtagcgtttggctctctcctctcgttcgccccagc
ctctcatcccttctaagtcaaagtcaaacgcgggggccggaagtctggggaagcctgttg
aagatgaagctgtggataaaaacattttcaaagactgcagcaaggttgctttctacaggt
gtattcataggatgcatttccggaaatggtattgctgcatcaaagaataagcgtcagaaa
catcagctctccaggagatccacctatcaggcattactagactcagtcacaactggcaaa
gacagcaccaagttccacatcatcaatgaaacaaccaaggttcctctactggccgaagtt
tatggtatagagggaaatattttcaggcttaaaataaatgaagaaactcccctgaaaccc
aggtatgaagttcctgatgtcctcacaatcaagcccagcactgtaaggctgatttcatgt
tcaggggatgcaggtagtctggtattggcagatggaaaaggagatctgaagtgtcatatc
acagcaaacccattcaagatagatttggtgtctgaagaagagattgtgatgagcataaac
tccctggaccaattgtactttgagcacctgcagattcctctcaagcaaagatctaccaaa
gaaaataaggaggacacatcagttgatgcttctcaggaagaccaagaggatctaggcctg
tgggaggagaaatttggaaaatttgtggatgtcaaagttaatggtcctgcctccattggt
ttggatttctccttgcatggatttgaacatctctacgggatcccacaacatgcagaatca
caccaacttaaaaatactagtgatggcgatgcttaccgtctttataacctggatgtctat
ggatataaaatacatgacaaaatgggcatttatggttcagtgccttatcttctggcccac
aagctaggcaggactctaggcattttttggcttaatgcctctgaaacactagtggagatc
aatacagaacctgcagtgaagtacacactgacccagatgggccctgttgcagctaaacaa
aagattagatgtcgaactgatgtgcactggatgtcagagagtggaatcattgatgttttt
ctgctaacaggacctacgccttctgacatcttcaagcagtactcataccttacaggcaca
caagccatgccccctctcttctccttggggtaccatcaatgccgctggaactatgaggat
gagcaggatgtaaaagcagtggatgcaggatttgatgaacatgacattccttatgatgtc
atgtggctggacatagagcataccgagggcaaaaggtacttcacttgggacaagaaaaga
ttcccaaatcccaaaaggatgcaagagctgctcagaagcaaaaaacgtaagcttgtggtc
atcagtgatccccacatcaagattgatcctgactactcagtgtattctaaggccaaagaa
cagggcttctttgtgaggaatcatgaaggaggagactttgaaggggtatgctggcctggt
ctctcctcttatctggatttcaccaatcccaaggtcagagagtggtattcaggtcttttc
actttctctgcttaccagggatctactgacatcctctacatatggaacgacatgaatgag
ccttctgtctttagagggccagagctaaccatgcagaagaatgccgttcatcatggcaac
tgggagcacagggaacttcacaacatctatggtttttatcagcacatggctactgcagaa
ggactgatacaacgatctgaggggaaggagagaccctttgttcttactcgttctttcttt
gctggatcacaaaagtatggtgctgtgtggacgggcgacaacacagcagaatggagctac
ctgaaaatttctatccctatgttactcaccctcagcattactgggatctctttttgtgga
gctgatgtaggcggcttcatcgggaatccagaggctgagctgctagtgcgatggtaccag
gctggagcctaccagcccttcttccgtggccatgctaccatgaagaccaagcggcgagaa
ccctggctctttggggaggagtacactcggctcatccgggaagccatcaggcagcgctat
gccctcctgccctattggtattttctcttctactgcgcacatgtggctgctgaaccagtc
atgaggcctctgtggatagagttcccagaggaattagacacttttggtgtagaagatgaa
tacatgctgggaagcgctttattggttcatccagtcacagaaccaaaagccaccacagtt
gatgtgttcctgccaggatcaaatgaggtctggtatgactctaaaacatttgctcattgg
gaaggagcatgtactgtgaagatcccggtagccttagacactataccggtatttcagcga
ggtggaagtatagtaccaataaagacaactataggaaaatccacaggctacatgtctgat
tccccgtatggactccgggtggccctcagtactaagggttctgccatgggtgaattctac
cttgacgatggccattcattccaatatctccaccagaagcaattcttgcacaggaagttt
tcattcttggcaggtgttttgatcaacagttgtgctgacaaaagaggtcattatcctacc
aagtgtgtggtggagcagatcttcatccaaggcctcaagaagcagccatcttctgtgacc
acccattcatctgatggtaaagaggagcctgtggcttttacatattgtgccaaaatgtct
accctgaggctagagaagctctcactgaacatcggcactgactgggaagtccacatcaga
tga

DBGET integrated database retrieval system