KEGG   Canis familiaris (dog): 487770Help
Entry
487770            CDS       T01007                                 

Gene name
TMPRSS2
Definition
(RefSeq) LOW QUALITY PROTEIN: transmembrane protease serine 2
  KO
K09633  transmembrane protease serine 2 [EC:3.4.21.-]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa05164  Influenza A
cfa05202  Transcriptional misregulation in cancer
cfa05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09160 Human Diseases
  09161 Cancers
   05202 Transcriptional misregulation in cancers
    487770 (TMPRSS2)
   05215 Prostate cancer
    487770 (TMPRSS2)
  09167 Infectious diseases
   05164 Influenza A
    487770 (TMPRSS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cfa01002]
    487770 (TMPRSS2)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     487770 (TMPRSS2)
Peptidases [BR:cfa01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   487770 (TMPRSS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin SRCR_2 SRCR Ldl_recept_a
Motif
Other DBs
NCBI-GeneID: 487770
NCBI-ProteinID: XP_022268981
VGNC: 53045
LinkDB All DBs
Position
31
AA seq 487 aa AA seqDB search
MALNSGSPPGVGPYYENHGYQPESLYPPQPATAPRAYPVYPAPYYPPAVPQYTPRVLTHT
STPAIHTQPKSPLGTGCTAKTKKALCITVVLGTILAGAAVAAVLLWKFMEDKCSVSGIEC
GSSGTCISPSQWCDGVLHCPSGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDNWSDSY
GRAACQDMGYRNSFYSSQGIADDSGATSFMKLNISAGHMDLYKKLYHSDVCSSKTVVSLR
CIGKHLSWAAVSWRCRQPRVQEHRPVRTSSSGDGRALAVPVSVSGLCMAPTLFPGPLHNP
RYWTAVAGILRQSFMFYGHGHRVGKVISHTNYDSKTKNNDIALMKLQTPLTFNDRVKPVC
LPNPGMMLEPEQSCWISGWGATYEKGKTSDELNAVMVPLIEPWRCNSKYVYNNLVTPAMI
CAGFLRGGVDSCQGDSGGPLVTLKSRVWWLIGDTSWGSGCAKANRPGVYGNVTVFTDWIY
RQMRANS
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atggccttaaactcagggtcaccgccaggagttggaccttactatgaaaaccatggatac
caacccgagagcctgtaccccccgcagcccgctacggcccccagagcctacccggtgtat
ccggccccgtactacccgcctgcagtgccccagtacaccccgagggtgctgacgcacact
tcgacacctgccatccacacgcagcccaagtccccgttggggacggggtgcaccgcaaag
actaagaaagcgctgtgcatcaccgtcgtcctggggaccatcctggcgggggcagctgtg
gcggcggtcctgctctggaagttcatggaggacaagtgctcggtgtccgggatagagtgc
ggcagctcggggacctgcatcagcccctctcagtggtgcgacggggtcctgcactgcccc
agcggggaggacgagaaccggtgcgttcgcctctacggaccgaactttatcctccaggtg
tactcgtcccagaggaagtcctggcaccccgtgtgtcaggacaactggagtgacagctac
gggagggccgcatgccaggacatgggttaccggaatagtttctattcgagccaaggaata
gcggatgacagcggggccaccagcttcatgaagctgaacataagcgccggccatatggat
ctctacaagaaactgtaccacagtgacgtctgttcttcaaaaacggtggtttctttacgc
tgtatagggaaacacctgtcttgggccgcggtgtcctggagatgccgtcagcctcgcgtc
caggagcaccgtcccgtgaggacgtcgagctcgggagacggacgggccctggcagttccc
gtctctgtgtcgggattatgtatggctcccacacttttcccaggacctctacacaacccg
cggtactggacggccgtggcgggaattttgagacaatccttcatgttctatggacacgga
caccgagtgggaaaagtgatttcccatacaaattatgattccaagaccaagaacaacgac
atcgccctcatgaagttgcagacgcctctgacttttaacgacagagtgaagccagtgtgc
ctgcctaacccgggcatgatgctagagccggagcagtcctgctggatttccgggtggggg
gccacctacgagaaagggaagacctcagacgagctgaacgcggtcatggtgcccctcatc
gagccctggcgctgcaacagcaagtacgtctacaacaacctggtcactccggccatgatc
tgtgcgggcttcctgcggggaggcgtcgactcctgccagggtgacagcggaggtcccctg
gtcactctgaagagccgcgtctggtggttgatcggcgacacgagctggggatccggctgt
gccaaggctaacaggccgggagtgtacggaaacgtgaccgttttcaccgactggatttat
cggcaaatgagggcaaacagctga

DBGET integrated database retrieval system