KEGG   Canis familiaris (dog): 489096Help
Entry
489096            CDS       T01007                                 

Gene name
HK3
Definition
(RefSeq) hexokinase-3 isoform X1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00010  Glycolysis / Gluconeogenesis
cfa00051  Fructose and mannose metabolism
cfa00052  Galactose metabolism
cfa00500  Starch and sucrose metabolism
cfa00520  Amino sugar and nucleotide sugar metabolism
cfa00524  Neomycin, kanamycin and gentamicin biosynthesis
cfa01100  Metabolic pathways
cfa01200  Carbon metabolism
cfa04066  HIF-1 signaling pathway
cfa04910  Insulin signaling pathway
cfa04930  Type II diabetes mellitus
cfa04973  Carbohydrate digestion and absorption
cfa05230  Central carbon metabolism in cancer
Module
cfa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cfa_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    489096 (HK3)
   00051 Fructose and mannose metabolism
    489096 (HK3)
   00052 Galactose metabolism
    489096 (HK3)
   00500 Starch and sucrose metabolism
    489096 (HK3)
   00520 Amino sugar and nucleotide sugar metabolism
    489096 (HK3)
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    489096 (HK3)
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    489096 (HK3)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    489096 (HK3)
  Digestive system
   04973 Carbohydrate digestion and absorption
    489096 (HK3)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    489096 (HK3)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    489096 (HK3)
Enzymes [BR:cfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     489096 (HK3)
Membrane trafficking [BR:cfa04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    489096 (HK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 489096
NCBI-ProteinID: XP_022273380
Ensembl: ENSCAFG00000016584
VGNC: 41700
UniProt: E2R8C2
LinkDB All DBs
Position
4
AA seq 970 aa AA seqDB search
MLGFSIFPEVSGMPHTEREELTPKESNQLLLPGGHPPMWNHMDSIGPIGLPHREGVPGCS
QEGLPYPSNSSELPVSPQVLECLQQFKVTGTQLQQIQASLLDSMEQALGGQASPASAVRM
LPTYVGSIPHGTEQGDFVVLELGATGASLRVLWVTLMGTGGHRMEPRSQEFVIPPEVMLG
PGQQLFDFAAHCLSEFLDALPVGKQGLQLGFSFSFPCHQTGLDRSTLISWTKGFRCSGVE
GHDVVQLLRDAIKRHGAYNIDVVAVVNDTVGTMMGCEPGVGPCEVGLVVDTGTNACYMEE
ARHVAVLDEDRGRVCVSVEWGSFGDDGVLGPMLTIFDHALDRESLNPGAQRFEKMIGGLY
LGELVRLVLVHLAQRGVLFGGCTSPALLSRGSILLEHVAEMEDPWAGAARVHALLQDLGL
NVGASDVELVQYVCAAVFTRAARLCAAALAAVLSRLQHSREQQILQIAVATGGRVFEQHP
SFLSILQETVMLLTPECDVSFIPSVDGGGRGVAMVTAVAARLAAHRHLLEETLAPFQLNH
EQLAAVQAQMREAMVKGLRGEASSLRMLPTYVRATPDGSERGDFLALDLGGTNFRVLLVR
VTAEGVKITNQIYSIPENVAQGSGQQLFDHIVDCIVDFQQKQGLSGQSLPLGFTFSFPCR
QLGLDQGILLNWTKGFSASDCEGQDIVCLLREAIGRRQAVELNVVAIVNDTVGTMMSCGY
EDPRCEVGLIVGTGTNACYMEELRNVAAVAGDSGQMCINMEWGAFGDDGSLGLLRTCFDA
SVDQASINPGKQSFEKMISGMYLGEIVRHILLHLTSLGVLFRGQQTQRLQTRDIFKTKFL
SEIESDSLALRQVRAILEDLGLSLTSDDALMVLEVCQAVSQRAAQLCGAGVAAVVEKIRE
NRGLEELTVSIGVDGTLYKLHPHFSSLVAATVRELAPRCVVTFLQSEDGSGKGAALVTAV
ACRLAQMARV
NT seq 2913 nt NT seq  +upstreamnt  +downstreamnt
atgctaggcttctccatctttccagaggtcagtggaatgcctcacactgagagagaagag
ctcacgcctaaggaaagtaaccaactacttctcccaggtggccaccctccaatgtggaac
cacatggactccattgggccaatagggttgccgcacagggaaggagtccctggctgctcc
caggagggcttgccctacccctcaaacagctctgagctgcctgtttctccccaggtgttg
gagtgtctacagcagttcaaggtgacggggacacagctgcagcagatccaagccagcctc
ctggactctatggagcaggcactggggggtcaggccagccctgcctctgctgtccggatg
ctgcccacatacgtggggtccatcccacatggcactgagcaaggagattttgtggtgctg
gagctgggggccacaggggcctcactgcgtgttctgtgggtgaccctgatgggcactggg
gggcataggatggagccccggagccaggagtttgtgatccccccagaggtgatgctgggt
cctggtcagcagctctttgactttgctgcccactgcctgtctgaattcctggatgcactc
cccgtgggaaaacaaggtctacaacttgggttcagcttctccttcccttgtcaccagaca
ggcctggacaggagcacccttatttcctggaccaaaggttttaggtgcagtggtgtggaa
ggccacgatgtggtccagttgctgcgagatgccatcaagaggcatggggcctacaacatc
gatgtggttgctgtggtgaatgacacagtgggcaccatgatgggctgcgagccaggggtt
gggccgtgtgaggtcgggcttgttgtagacactggcaccaatgcatgttacatggaggag
gcaaggcatgtggcagtgctggacgaggaccggggccgtgtctgcgtcagcgttgagtgg
ggctccttcggtgatgatggggtcctgggaccaatgctgaccatctttgatcatgctttg
gatcgagagtccctgaatcctggtgcccagaggtttgagaagatgattgggggcttgtac
ctgggtgagctggtgaggcttgtgttggttcacctggcccagcgaggggtcctctttggt
ggctgcacctcccctgccctgctgagccgaggtagcatcctcctggagcacgtggctgag
atggaggacccctgggctggggcagcccgtgtgcatgctctcctgcaggacttgggcctg
aacgtgggggcctcagatgttgagctcgtgcagtatgtatgtgcagctgtgtttactcgg
gctgcccggctctgtgctgccgccctggctgctgttctctctcgcctccagcacagccgg
gagcagcagatacttcagattgctgtggccaccggaggccgagtatttgagcaacacccc
agttttctcagcatcctgcaggagactgtaatgctcctaacccccgaatgtgatgtctcc
ttcattccctctgtggatgggggtggccggggcgtggcaatggtgactgctgtggctgcc
cgcctggctgctcaccggcacctgctggaagagaccctggcacctttccaattgaaccat
gaacagctggcagcagtgcaggcacagatgcgggaggccatggtcaaggggctccgaggg
gaggcatcatccctccgcatgttgcccacttatgtccgggccacgcctgatggcagtgag
cgtggggacttcctggccctggacctggggggcaccaacttccgggttctcctggtgcgt
gtgactgcagaaggtgtgaagatcaccaaccagatctattccatcccagagaatgtggcc
cagggctctggacagcagctctttgatcacatcgtggactgcattgtggacttccagcag
aagcagggcctgagtgggcagagccttccgctgggtttcaccttctccttcccatgcagg
cagcttggccttgatcagggcatcctcctaaattggacaaagggtttcagtgcgtcagat
tgtgagggtcaagacattgtgtgtctgcttcgggaagccattgggcgaagacaggcagtg
gagctgaatgtggttgccattgtgaatgacacggtggggaccatgatgtcctgtggctat
gaggatccccgttgtgaggtcggcctcatcgttgggactggcaccaatgcctgttacatg
gaagagcttcggaatgtggcagctgtagctggggactcagggcagatgtgcatcaatatg
gagtggggtgcctttggggatgatgggtctctgggcttacttagaacctgctttgatgca
agtgtggaccaggcatccatcaaccctggcaagcagagttttgagaagatgatcagtggc
atgtacctgggagagattgtccgccacattcttttgcatttgaccagccttggagttctt
ttccggggccagcagacccagcgccttcagaccagggacatcttcaagaccaagtttctc
tctgagattgaaagtgacagtctagctctgaggcaggtccgagccatcctggaagatctg
gggctgtccctgacttcagatgatgccctgatggtcctggaggtgtgccaagctgtgtcc
cagcgggctgcccagctctgtggggcaggtgtggctgctgtggtggagaagatccgtgag
aaccggggcctagaagagctgactgtgtccataggggtggatgggaccctctataagcta
cacccccacttctccagcctggtggcagccaccgtgagggagctggcccctcgctgtgtg
gtcaccttcctgcagtcagaagatgggtccggcaaaggtgcagccctggtcactgctgtt
gcctgccgccttgcccagatggcccgtgtttga

DBGET integrated database retrieval system