KEGG   Canis familiaris (dog): 489790Help
Entry
489790            CDS       T01007                                 

Gene name
GALNT17
Definition
(RefSeq) putative polypeptide N-acetylgalactosaminyltransferase-like protein 3 isoform X2
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00512  Mucin type O-glycan biosynthesis
cfa01100  Metabolic pathways
Module
cfa_M00056  O-glycan biosynthesis, mucin type core
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    489790 (GALNT17)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:cfa01003]
    489790 (GALNT17)
Enzymes [BR:cfa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     489790 (GALNT17)
Glycosyltransferases [BR:cfa01003]
 O-Glycan biosynthesis
  Mucin-type
   489790 (GALNT17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin RicinB_lectin_2 Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 489790
NCBI-ProteinID: XP_022275237
Ensembl: ENSCAFG00000011150
VGNC: 41092
LinkDB All DBs
Position
6
AA seq 575 aa AA seqDB search
MGYAGLLLLGWCVCVCVCAHTHACFSCPDDKELHELTRHQTAFRRSLYLSWSLYISCLSK
SLGLIEGYGGRGKGGLPATLSPAEEEKAKGPHEKYGYNSYLSEKISLDRSIPDYRPTKCK
ELKYAKELPQISIIFIFVNEALSVILRSVHSAVNHTPTHLLKEIILVDDNSDEEELKAPL
EEYVHKRYPGLVKVVRNQKREGLIRARIEGWKVATGQVTGFFDAHVEFTAGWAEPVLSRI
QENRKRVILPSIDNIKQDTFEVQRYENSAHGYSWELWCMYISPPKDWWDAGDPSLPIRTP
AMIGCSFVVNRKFFGEIGLLDPGMDVYGGENIELGIKVWLCGGSMEVLPCSRVAHIERKK
KPYNSNIGFYTKRNALRVAEVWMDDYKSHVYIAWNLPLENPGIDIGDVSERRALRKSLKC
KNFQWYLDHVYPEMRRYNNTIAYGELRNNKAKDVCLDQGPLENHTAILYPCHGWGPQLAR
YTKEGFLHLGALGTTTLLPDTRCLVDNSKSRLPQLLDCDKVKSSLYKRWNFIQNGAIMNK
GTGRCLEVENRGLAGIDLILRSCTGQRWTIKNSIK
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgggatatgccggcctcttgctcttgggctggtgtgtgtgtgtgtgtgtgtgtgcacac
acacatgcctgcttcagctgcccagatgataaggagcttcatgagttgacgaggcaccag
actgcatttcgccgcagcctctatctatcctggagtttgtacatcagttgcttatccaaa
tcccttgggctcatcgaaggttatggtgggcggggcaaagggggccttcctgctaccctg
tccccggctgaagaggagaaagccaagggcccccatgagaagtatggctacaattcctac
ctcagtgaaaaaatttcactggatcgttccattccggattatcgtcctaccaagtgcaag
gagctgaagtacgccaaggagctgccccagatctccatcatatttatcttcgtgaacgag
gccctgtcggtgatcttgcggtccgtgcacagtgctgtcaatcacacaccgacacacctg
ctgaaggaaatcatcctggtggacgacaacagtgacgaagaggagctgaaggcccccttg
gaggagtacgttcacaagcgctaccctgggctggtgaaggtggtgcgcaaccaaaaaaga
gagggcctgatccgagctcgcatcgagggctggaaagtggccactggccaggtcactggc
ttctttgatgcccacgtggaattcactgctggctgggccgagccagttctgtcccgaatc
caagagaaccggaagcgagtgatcctcccgtccatcgacaacatcaaacaggacaccttt
gaggtgcagcggtacgagaactcggcccatggctacagctgggagctgtggtgcatgtac
atcagccccccaaaagactggtgggacgccggagacccttctctccccatcaggactcca
gccatgattggctgctcctttgtggtcaacaggaagttttttggtgaaatcggtcttctc
gaccctggaatggatgtgtatgggggagaaaatatcgaacttggaatcaaggtgtggctc
tgcgggggcagcatggaggtcctgccttgctcacgagtggcccacatcgagcggaagaag
aagccctacaacagcaacattggcttctacaccaagaggaatgctctccgggttgccgag
gtctggatggatgattacaagtcccatgtgtacatagcgtggaacctgccactggagaat
ccaggaattgacataggtgatgtctccgaaagaagagccttaaggaaaagtttaaagtgt
aagaatttccagtggtacctggaccacgtttacccagaaatgagaagatacaataacacc
attgcatacggggagcttcgaaacaacaaggcaaaagacgtctgcttggaccaggggccg
ctggagaaccacacagcaatactgtacccgtgccatggctggggaccccagcttgcccgc
tacaccaaggagggcttcctgcatttgggagccctggggaccaccacgctcctccctgac
acccgctgtctggtggacaactccaagagtcggctaccccagctcctagactgtgacaaa
gtcaagagcagcctgtacaagcgctggaatttcatacagaatggagccatcatgaataaa
ggcacaggccgctgtctggaagtggagaaccggggcctggctggcatcgacctcatcctc
cgcagctgcacgggacagaggtggacaattaagaactccatcaagtag

DBGET integrated database retrieval system