KEGG   Canis lupus familiaris (dog): 490305
Entry
490305            CDS       T01007                                 

Gene name
CACNA1E
Definition
(RefSeq) voltage-dependent R-type calcium channel subunit alpha-1E isoform X1
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa04010  MAPK signaling pathway
cfa04020  Calcium signaling pathway
cfa04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    490305 (CACNA1E)
   04020 Calcium signaling pathway
    490305 (CACNA1E)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    490305 (CACNA1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:cfa04040]
    490305 (CACNA1E)
Ion channels [BR:cfa04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   490305 (CACNA1E)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel Lustrin_cystein
Other DBs
NCBI-GeneID: 490305
NCBI-ProteinID: XP_022276636
Ensembl: ENSCAFG00000013004
VGNC: 38635
LinkDB
Position
7
AA seq 2465 aa
MRGPSPGRRLPEPAPCPAAAGSPEPWAAGRRRHVLALPEEEAWRPQQCSLLEADASDEVG
MLPASPRAAASGVDNFFPVQEGEGAGWEGGAALDAGAGPFLPVSPEVMKRRRGGLIEQRD
IIKAHEAHKMQSTPQARRKEWEMARFGEAVVGRPGSGDGDSDQSRNRQGTPVPASGPAAA
YKQSKAQRARTMALYNPIPVRQNCFTVNRSLFIFGEDNIVRKYAKKLIDWPPFEYMILAT
IIANCIVLALEQHLPEDDKTPMSRRLEKTEPYFIGIFCFEAGIKIVALGFIFHKGSYLRN
GWNVMDFIVVLSGILATAGTHFNTHVDLRTLRAVRVLRPLKLVSGIPSLQIVLKSIMKAM
VPLLQIGLLLFFAILMFAIIGLEFYSGKLHRACFTNNSGILEGFDPPHPCGVQGCPAGYE
CRDWIGPNDGITQFDNILFAVLTVFQCITMEGWTTVLYNTNDALGATWNWLYFIPLIIIG
SFFVLNLVLGVLSGEFAKERERVENRRAFMKLRRQQQIERELNGYRAWIDKAEEVMLAEE
NKNAGTSALEVLRRATIKRSRTEAMTRDSSDEHCVDISSVGTPLARASIKSAKVDGASYF
RHKERLLRISIRHMVKSQVFYWIVLSLVALNTACVAIVHHNQPQWLTHLLYYAEFLFLGL
FLLEMSLKMYGMGPRLYFHSSFNCFDFGVTVGSIFEVVWAIFRPGTSFGISVLRALRLLR
IFKITKYWASLRNLVVSLMSSMKSIISLLFLLFLFIVVFALLGMQLFGGRFNFNDGTPSA
NFDTFPAAIMTVFQILTGEDWNEVMYNGIRSQGGVSSGMWSAIYFIVLTLFGNYTLLNVF
LAIAVDNLANAQELTKDEQEEEEAFNQKHALQKAKEVSPMSAPNMPSIERDRRRRHHMSM
WEPRSSHLRERRRRHHMSVWEQRTSQLRRHMQMSSQEALNKEEAPPMNPLNPLNPLSPLN
PLNAHPSLYRRPRPIEGLGLGLEKCEEERIISRGGSLKGDGGDLSSALDNQRSPLSLGKR
EPPWLARPCHGNCDPTQQEAGGGETVVTFEDRARHRQSQRRSRHRRVRTEGKELSSTSRS
RSVSQERSLDEGVLTDGEKEREPRGGHAGKEPTIQEEDRGQDLRRTNSLMVPRGSGLAGA
LDEANTPLVLPHHDLEVGKDTVLTEQEPEGSSEQALLGDVQLDIGRVISQSEPDLSCVTA
NTDKATTDSTSVTVAIPDVGPLMDSTVIHISNKTDGEASPLKEAEIKEEEEEMEKKQQKK
EKRETGKAMVPHSSMFIFSTTNPIRRACHYIVNLRYFEMCILLVIAASSIALAAEDPVLT
NSERNKVLRYFDYVFTGVFTFEMVIKMIDQGLILQDGSYFRDLWNILDFVVVVGALVAFA
LANALGTNKGRDIKTIKSLRVLRVLRPLKTIKRLPKLKAVFDCVVTSLKNVFNILIVYKL
FMFIFAVIAVQLFKGKFFYCTDSSKDTEKECIGNYVDHEKNKMEVKGREWKRHEFHYDNI
IWALLTLFTVSTGEGWPQVLQHSVDVTEEDRGPSRSNRMEMSIFYVVYFVVFPFFFVNIF
VALIIITFQEQGDKMMEECSLEKNERACIDFAISAKPLTRYMPQNRHTFQYRVWHFVVSP
SFEYTIMAMIALNTVVLMMKYYSAPCTYELALKYLNIAFTMVFSLECVLKIIAFGFLNYF
RDTWNIFDFITVIGSITEIILTDSKLVNTSGFNMSFLKLFRAARLIKLLRQGYTIRILLW
TFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGNIKLDEESHINRHNNFRSFFGSLMLLFR
SATGEAWQEIMLSCLGEKGCEPDTTAPSGQNENERCGTDLAYVYFVSFIFFCSFLMLNLF
VAVIMDNFEYLTRDSSILGPHHLDEFVRVWAEYDRAACGRIHYTEMYEMLTLMSPPLGLG
KRCPSKVAYKRLVLMNMPVAEDMTVHFTSTLMALIRTALDIKIAKGGADRQQLDSELQKE
TLAIWPHLSQKMLDLLVPMPKASDLTVGKIYAAMMIMDYYKQSKVKKQRQQLEEQKNAPM
FQRMEPSSLPQEIIANAKALPYLQQDPVSGLSGRSGYPSMSPLSPQEIFQLACMDPADDG
QFQEHQSLEPEVSELKSVQSSNHGIYLPSDTQEHTGSGRASSMPRLTVDPQVVTDTSSMR
RSFSTIRDKRSNSSWLEEFSMERSSENTYKSRRRSYHSSLRLSAHRLNSDSGHKSDTHRS
GGRERGRSKERKHLLSPDVSRCNSEERGTQADWESPERQQSRSPSEARSQTPNRQGTGSL
SESSIPSISDTSTPRRSRRQLPPVPPKPRPLLSYSSLIRHSGSISPPADGSERGSPLTPQ
ALESTEAGLAEPSGPRHGHGQGHGQGHGQQSQHCSPQRYISEPYLALHEDSHASDCGEEE
TLTFEAAVATSLGRSNTIGSAPPLRHSWQMPNGHYRRRRRGGPGPGVMCGAVSDLLSDTE
EDDKC
NT seq 7398 nt   +upstreamnt  +downstreamnt
atgcgtggaccgagcccaggccgcaggctgcccgagcccgccccctgccccgccgcggcc
gggagccctgagccctgggccgcgggccgccgccgccacgtcctggccctgcctgaggag
gaggcatggaggccccagcagtgctccctgctcgaggccgacgcctcggacgaggtgggc
atgctgccggcctccccgcgcgccgccgcctccggcgtcgacaacttcttcccggtgcag
gagggcgagggcgcgggctgggagggcggtgcggccctggacgccggcgccggccccttc
ctcccggtgagccccgaggtgatgaagcggcggcgcgggggcctcatcgagcagcgcgac
atcatcaaggcccacgaggcgcacaagatgcagagcaccccgcaggcgcggcgcaaggag
tgggagatggctcgcttcggggaggcggtggtcggcaggccggggtcgggcgatggagac
tcggaccagagcaggaaccggcaaggaaccccggtgccggcctcggggccggcggccgcc
tacaagcagtcgaaagcgcagagggcgcggactatggctttgtacaaccccattcccgtc
cggcagaactgtttcaccgtcaacagatccctgttcatcttcggagaagataacattgtc
aggaaatacgccaagaagctcatcgactggccgccgtttgagtacatgattttggcaacc
atcattgccaactgcattgtcttggccctggaacagcatcttcctgaggatgacaagacc
ccgatgtcccgcagactggagaagacagagccgtatttcattgggatcttttgctttgaa
gccggtatcaaaattgtggccctggggttcatctttcataagggctcgtacctccgcaat
ggctggaatgtcatggacttcatcgtggtcctcagtggcatcctggccactgcggggact
cacttcaacacacacgtggacctgaggaccctccgggctgtgcgtgtcctgagacccctg
aagctcgtgtcagggattcctagcctgcagatcgtgttgaagtctatcatgaaggccatg
gtgcctcttctgcaaattggtctcctgctcttctttgccatcttgatgtttgctatcatt
ggcttagagttctacagtgggaagttgcaccgagcatgtttcacgaacaattcaggtatt
ctggaaggatttgacccccctcacccatgtggtgtgcagggctgcccagctggctacgaa
tgccgggactggattggccccaatgatgggatcacccagtttgataacatcctttttgct
gtgctgactgtcttccaatgcatcaccatggaaggatggaccaccgtgctgtacaatacc
aatgatgccttaggagccacctggaactggctgtacttcatccccctcatcatcattgga
tccttctttgttctcaacctagttctgggagtgctttccggggagtttgccaaagagaga
gagagagtggagaaccggagagctttcatgaaactgcggcggcagcagcagattgagcgg
gagctgaacgggtaccgcgcctggatagacaaagcagaggaagtcatgcttgctgaagaa
aataaaaatgctgggacgtcagccttagaagtgcttcgaagggcaaccatcaaaaggagc
cggacagaggccatgactcgagactccagtgatgaacactgtgtcgatatctcctctgtg
ggcacacctctcgcccgagccagcatcaaaagtgcaaaggtggatggggcctcctatttc
cggcacaaagaaaggcttctgcgcatctctatccgccacatggtgaaatcccaggtgttt
tactggattgtgttgagccttgtggctctcaacactgcctgtgtggccatcgtccatcat
aaccagccccagtggctcacccatctcctctactatgcagaatttttgtttctgggactg
ttcctcttggagatgtccctgaagatgtatggcatgggacctcgactttattttcactct
tcattcaactgttttgattttggggtcacagtgggcagcatctttgaagtggtctgggca
atcttcagacctggcacatcttttggaatcagtgtcttacgggctctccggcttctaaga
atatttaaaataaccaagtattgggcatctctgcgaaatttggtggtctccttgatgagc
tctatgaagtctatcatcagtttgctcttcctcctcttcctcttcatcgttgtctttgct
ctcctaggaatgcagctgtttggaggcaggtttaactttaatgatgggactccttcagca
aactttgataccttccctgcagccatcatgactgtattccagatcctaacaggtgaggac
tggaatgaggtgatgtacaatgggatccgttcccagggtggagttagctcaggcatgtgg
tcagctatctatttcattgtgctcaccttgtttggaaactacacactgctgaatgtgttc
ttggccattgctgtggacaatctggccaatgcccaagagctgaccaaggatgaacaagaa
gaagaggaggcttttaaccagaaacatgcattgcagaaggccaaggaggtcagcccgatg
tctgcacccaacatgccttctatcgaaagagacagaaggagaagacaccacatgtcgatg
tgggagccacgcagcagccacctgagggagcggaggcgccggcaccacatgtcggtgtgg
gagcagcgcaccagccagctgagaaggcacatgcagatgtccagccaggaggccctcaat
aaagaggaggccccaccgatgaaccccctcaaccccctcaacccgctgagccccctcaac
ccgctcaacgcccaccccagcctctaccggagacctaggcctattgagggcctgggcctg
ggcctggagaagtgtgaggaggagcgcatcatcagccgcggggggtccctcaagggggac
ggaggggacctgtcgagtgccctggacaaccagaggagccctttgtccctgggcaaacgg
gagccaccatggctggccaggccctgtcatgggaactgtgatccgacccagcaggaggct
gggggaggggagaccgtggtgaccttcgaggaccgggccaggcacaggcagagccagcgg
cgcagccggcaccgtcgtgtcaggacggaaggcaaggagctctcctccacctcccggagc
aggtctgtcagccaggagcggagtctggatgagggggtgctcaccgacggggagaaggag
cgagagcccaggggcggccatgcaggcaaagaacccaccatccaagaagaagacagaggc
caagacttaaggaggacgaacagtctgatggtgcccagaggctctgggctggcaggagcc
cttgatgaggccaacacacccctagtcctgccccaccacgatctggaagtggggaaggac
acggtgctgacggagcaggagccggagggcagcagcgagcaggccctgctgggggatgtg
cagttggacattggcagggtcatcagccagagtgagcctgacctctcctgcgtcacagcc
aacacagacaaggccaccaccgacagcaccagcgtcaccgtcgccatccctgatgtgggc
cccttgatggactcaactgtgattcacattagcaacaaaactgatggagaagccagtccc
ttgaaggaggctgagatcaaagaggaggaggaggaaatggagaagaagcagcagaagaag
gagaagcgtgagacgggcaaagccatggtgccccacagctctatgttcatcttcagcacc
accaacccgattcgcagggcctgccactacatcgtgaacctgcgctactttgagatgtgc
attctcctggtgatcgccgccagcagcattgccctggcagcagaggaccccgtcctgacc
aactcggagcgcaacaaagtcctgaggtattttgactatgttttcactggcgtgttcacc
tttgagatggttataaagatgatagaccagggcttgatcctacaggatgggtcctacttc
cgagacctgtggaacatcctggactttgtggtggtggttggtgcattggtggcctttgct
ttggcgaacgctttgggaacaaacaaggggcgagacatcaagaccatcaaatccctgagg
gtgctccgagttctgaggccactgaagaccatcaagcgcttgcccaaactcaaggctgtc
tttgactgtgtggtgacctccttgaagaatgtcttcaacatactcatcgtctataagctc
ttcatgttcatctttgctgtcattgcggttcagctcttcaagggaaaattcttttattgc
acagacagttccaaggacacagagaaggagtgcataggcaactacgtagatcatgaaaaa
aacaagatggaggtgaaaggccgggaatggaagcgccatgaattccactacgacaacatt
atctgggccctgctgaccctcttcaccgtctccacgggggaaggatggcctcaagtctta
cagcattctgtcgatgtgacagaggaagaccgaggaccaagccgcagcaaccgcatggag
atgtccatcttctatgtggtctactttgtggtcttccctttcttctttgtcaatatcttt
gtggctctgatcatcatcaccttccaggaacaaggggacaagatgatggaggaatgcagc
ctggagaagaacgagagggcgtgcattgacttcgccatcagtgccaaacctctcacccgc
tacatgccacagaacaggcacaccttccagtaccgcgtctggcacttcgtggtgtctccg
tcctttgagtacaccatcatggccatgatcgccctgaacaccgtcgtgctgatgatgaag
tactactctgctccctgtacctatgaactggccctgaagtacctgaatattgccttcacc
atggtgttttccctggaatgtgtcctaaagatcatcgcttttggcttcttgaactacttt
cgagacacctggaacatctttgacttcatcactgtgattggcagtatcacagaaatcata
ctgacagacagcaagctggtaaacaccagtggtttcaacatgagctttctgaagctcttc
cgtgccgcccgcctcatcaagcttctgcggcagggctacaccatccgtattttactctgg
accttcgtgcagtcctttaaggccctcccctacgtctgccttttgattgccatgcttttc
ttcatctatgccatcattgggatgcaggtatttggaaacataaaattagatgaggagagt
cacatcaaccggcacaacaacttccggagtttctttgggtccctcatgttactcttcagg
agtgccacgggagaggcctggcaggagataatgctgtcgtgcctcggggagaaaggctgc
gagcccgacaccactgcgccatcggggcagaacgagaatgagcgctgtggcaccgatctg
gcctatgtttactttgtctccttcatcttcttctgctctttcttgatgctcaacttgttt
gtggccgtcatcatggacaacttcgagtacctgactcgggactcctccatcttagggccc
caccacttggatgagtttgtccgcgtctgggcagagtacgaccgagctgcatgtggccgc
atccattatactgagatgtatgaaatgctgactctcatgtcaccaccgctaggcctcggc
aagagatgtccctccaaagtggcatataagaggttggtcctaatgaatatgccagtagct
gaggacatgacagtccacttcacctccacactgatggctctgatccggacagccctggac
atcaaaatcgccaaaggtggtgcagacaggcagcagctagactcggagctgcaaaaggag
accctggccatctggcctcacctgtcccagaagatgctagacctgcttgtgcccatgccc
aaagcctctgacctgactgtgggcaaaatctatgcagcaatgatgatcatggactactat
aaacagagtaaggtgaagaaacagaggcagcagctggaggaacagaaaaatgcacccatg
ttccagcgaatggagccctcatctctgcctcaggagatcattgctaatgccaaagccctg
ccctatctccagcaggaccccgtttcaggcctgagtggccgtagtggatacccttcgatg
agtccactctccccccaggaaatattccaattggcttgtatggatccagccgatgatgga
cagttccaggaacatcagtctctggagccagaggttagtgaattaaaaagcgtgcagtcc
tctaaccatggcatctaccttccttcggacacccaggagcatacgggatctgggagggca
tcttctatgccacgcctgactgtggatccccaggtggtgacagatactagctccatgaga
cgttcattttccactattcgggataagcgttcaaattcctcctggttggaggaattctcc
atggagagaagcagtgaaaacacctacaagtcacgtcgtcggagttaccactcctccctg
agactgtcagctcatcgcctgaattctgactcaggccacaagtctgacacccaccgctca
gggggtagagagcggggacgatcgaaagagcgaaagcatcttctctctcctgatgtctcc
cgctgcaactcagaggagcgagggacccaggccgactgggagtccccagagcgccaacag
tccaggtctcccagtgaggccaggtcacagacccccaacagacagggcacgggctccctg
agcgagagctccatcccctccatctctgacaccagcaccccaagacgaagtcgccggcag
ctcccacccgtcccaccaaagcctcggcccctcctctcctacagctccctgattcgacac
tccgggagcatctccccgccggccgacggaagcgagaggggctccccgctgaccccccag
gcgctggagagcacggaggccggcctggcggagccctcgggcccccggcacgggcacggg
caggggcacgggcaggggcacgggcagcagagccagcactgctccccgcagcgctacatc
tccgagccctacctggccctgcacgaagactcccacgcgtcggactgtggcgaggaggag
acgctcaccttcgaggccgccgtggccaccagcctgggccgctccaacaccatcggctcg
gccccgccgctgcggcacagctggcagatgcccaacgggcactatcggcggcggcggcgc
ggggggccggggccgggcgtgatgtgcggggcggtcagcgacctcctgagtgacacggaa
gaagacgacaagtgctag

DBGET integrated database retrieval system