KEGG   Canis familiaris (dog): 490806Help
Entry
490806            CDS       T01007                                 

Gene name
GSTZ1
Definition
(RefSeq) maleylacetoacetate isomerase isoform X1
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00350  Tyrosine metabolism
cfa01100  Metabolic pathways
Module
cfa_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    490806 (GSTZ1)
Enzymes [BR:cfa01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     490806 (GSTZ1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_3 GST_C GST_C_2 GST_N_4
Motif
Other DBs
NCBI-GeneID: 490806
NCBI-ProteinID: XP_005623761
Ensembl: ENSCAFG00000017185
VGNC: 41537
UniProt: E2RT24
LinkDB All DBs
Position
8
AA seq 217 aa AA seqDB search
MTESGKPILYSYFRSSCSWRVRIALALKNIDYETIPTNLIKDGGQQFSKEFQALNPMKQV
PVLKIDGITIGQSLAIIEYLEETRPTPRLLPQDPKKRAYVHMISNLIVSGIQPLQNLSVL
KQLRQENNLPWAQKAISSGFQALEQILQGTAGKYCVGDEVTMADLCLVPQVANAERFEVD
LTPYPAISRINKTLLALEAFQVSHPCRQPDTPPELRA
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgactgagtctggcaagcccatcctctactcctatttccggagctcctgttcatggaga
gttcgaatcgctctggccttgaaaaacatagactatgagaccatacctaccaacctcata
aaggatgggggacagcagttctctaaagaattccaggcactgaatcccatgaaacaggtg
ccagtcctgaagatagatggaatcaccattggccagtcactggccatcattgagtacctg
gaggagacacggcccacgccccgactcctgcctcaggacccgaagaagagggcctatgtg
cacatgatttccaatctcatcgtcagtggcatccaacctctgcagaacctgtctgtcctg
aaacaactgagacaggagaacaatctgccctgggcccagaaagccatcagttctggcttt
caagctctggagcagatcctgcagggcacagcagggaaatactgtgtgggagatgaggtg
accatggctgatctctgcttagtgcctcaggtggcaaacgctgaaaggttcgaggtggat
ctcactccctatcctgccatcagccgcatcaacaagacgctgctggccttggaggctttc
caagtgtctcacccctgccggcagccagacactccccctgagctgagggcctag

DBGET integrated database retrieval system