KEGG   Canis familiaris (dog): 491145Help
Entry
491145            CDS       T01007                                 

Gene name
LIG3
Definition
(RefSeq) DNA ligase 3 isoform X1
  KO
K10776  DNA ligase 3 [EC:6.5.1.1]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa03410  Base excision repair
Module
cfa_M00296  BER complex
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    491145 (LIG3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cfa03400]
    491145 (LIG3)
Enzymes [BR:cfa01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     491145 (LIG3)
DNA repair and recombination proteins [BR:cfa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Short Patch-BER factors
     491145 (LIG3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N LIG3_BRCT zf-PARP DNA_ligase_A_C BRCT_2 RNA_ligase mRNA_cap_enzyme Synaptonemal_3 FAD_binding_1
Motif
Other DBs
NCBI-GeneID: 491145
NCBI-ProteinID: XP_005624869
Ensembl: ENSCAFG00000018330
VGNC: 42674
LinkDB All DBs
Position
9
AA seq 991 aa AA seqDB search
MTLAFKILFPPTFRALRRKELCLFREPHHWPDIRQFSHWSERGLLHGSCLLQRRKPVLSF
QEGSLRPRATCLVFLPGSHVGLCSGPCEMAEQRFCVDYAKRGTAGCKKCKEKIVKGVCRI
GKVVPNPFSESGGDMKEWYHVKCMFEKLERARATTKKIEDLTELEGWEELEDNEKEQISQ
HIADLSSKATGTPKKKAVVQAKLTATGQVTSPVKGASFVTNTNPRKFSGFSAKPNNSGEA
RSSPTPKASLSSSRCDPKHKDCLLREFRKLCAMVAENPSYNTKTQIIQDFLRKGSAGDGF
HGDVYLTVKLLLPGVIKSVYNLNDKQIVKLFSRIFNCNPDDMARDLEQGDVSETIRVFFE
QSRSFPPAAKSLLTIQEVDKFLLQLSKLTKEDEQQQALQDIASRCTANDLKCIIRLIKHD
LKMNSGAKHVLDALDPNAYEAFKASRNLQDVVERVLRNEQEVEKEPGQRRALSVQASLMT
PVQPMLAEACKSIEHAMKKCPNGMFSEIKYDGERVQVHKNGDHFSYFSRSLKPVLPHKVA
HFKDYIPQAFPGGHSMILDSEVLLIDTKTGKPLPFGTLGVHKKAAFQDANVCLFVFDCIY
FNDVSLMDRPLSERRKFLHDNMVEIPNRIMFSEMKQVTKASDLVDMINRVIREGLEGLVL
KDVKGTYEPGKRHWLKVKKDYLNEGAMADMADLVVLGAFYGQGSKGGMMSIFLMGCYDPS
SQKWCTVTKCSGGHDDATLARLQKELDMVKISKDPSKIPNWLKINKIYYPDFIVPDPKKA
AVWEITGAEFSRSEAHTADGISIRFPRCTRIRDDKDWKSATNLPQLKELYQLSKEKADFA
VAAGEEGSSTTGGSSSGGENGGVSGPAGASKAKKVGGRPSSPNDRGGHKLIAKPSPVKVG
QKRKAPDEASCPAKVLLDIFTGVRLYLPPSTPDFSRLRRYFVAFDGDLVQEFDMASATHV
LGSGDKNPEAQQVSPEWIWACIRKRRLVAPC
NT seq 2976 nt NT seq  +upstreamnt  +downstreamnt
atgactttggctttcaagatcctcttcccaccaaccttccgcgcactcaggcgaaaagaa
ttgtgcctgttccgagagccacatcactggcctgacataagacagttcagccattggtca
gaaagaggtctgcttcatgggtcctgcctcctccagagaagaaagcctgttctgtcattc
caggaaggcagtctaagaccacgtgccacctgccttgtttttttgccagggtcgcatgtg
ggactctgcagtgggccctgtgagatggctgagcaacggttctgtgtggactatgccaag
cgtggcacggctggctgcaaaaaatgcaaagaaaagattgtgaaaggtgtatgccggatt
ggcaaagtggtgcccaatcccttctcagagtccgggggtgatatgaaagagtggtatcac
gttaaatgcatgtttgagaaattggagcgggcccgggccaccacaaaaaaaattgaggac
ctcacagagctggaaggctgggaagagctggaagataatgagaaggaacagataagccag
cacattgcagatctgtcttctaaggcaacaggaacaccaaagaagaaagctgtcgtccag
gctaagctgacagccactggccaggtgacctctccagtgaaaggtgcctcatttgtcacc
aataccaatccccggaaattttctggtttttcagccaagcccaacaactctggggaagcc
cgctcaagccctacccctaaggcaagtttgtcctcaagcagatgtgatcccaagcacaag
gattgtctgctacgtgagtttcggaagctgtgtgccatggtggctgagaatcctagctac
aacacgaagacccagatcatccaggactttcttcggaaaggttcagcaggagatggtttc
cacggtgacgtgtacctaacagtgaagctgctgctgccgggtgttattaagagtgtttac
aacttgaatgataagcagattgtgaagcttttcagccgcatttttaactgcaacccagat
gatatggcacgggacctagagcagggcgacgtgtcagagacaatcagagtcttctttgag
cagagcagatctttccccccagctgccaagagccttcttaccatccaggaagtggacaaa
ttcctccttcagctctccaagctcaccaaggaggatgagcagcaacaggccctgcaggac
atcgcctccaggtgtacagccaatgaccttaagtgcatcatcagattgatcaaacacgat
ctgaagatgaactcgggtgcaaaacacgtgttagatgcccttgaccccaatgcctatgaa
gccttcaaagcctcacgcaacctgcaggatgtggtcgagcgggtcctccgcaacgagcag
gaggtggagaaggagccaggccagagacgagctctgagtgtccaggcttccttgatgacg
ccagtgcagcccatgctggccgaggcctgcaagtccatcgagcatgcgatgaagaagtgt
cctaacggcatgttttccgagatcaagtacgatggggaacgagtccaggtgcataagaac
ggggatcacttcagctacttcagccgcagccttaagcctgtgctgcctcacaaggtggcc
cactttaaggactacatcccccaggctttccctgggggccacagcatgatcttggactcc
gaggtgctcctgatcgacacgaagacaggcaaaccgctgccctttgggactcttggagtg
cacaagaaagctgccttccaggatgctaatgtctgcctttttgtttttgattgtatctac
ttcaatgatgtcagtttgatggataggcctctctctgagcgccggaagtttcttcatgac
aacatggtggaaattcccaaccggatcatgttctcagaaatgaagcaagtcactaaagct
tcagacttggtcgacatgataaaccgggtcatccgagaggggctggaagggctggtgctg
aaggacgtgaagggtacctatgagcctggaaagcggcactggctgaaagtgaagaaagac
tatttgaatgagggggccatggctgatatggcggacctggtggtccttggggccttctat
gggcaagggagcaaaggtggcatgatgtccatcttcctcatgggctgctatgacccaagt
agccagaagtggtgcacggtcaccaagtgttcaggaggccatgatgatgcgacccttgcc
cgcctgcagaaggaactggacatggtaaagatcagcaaggatcccagcaaaatacccaac
tggctgaaaatcaacaagatctactatcctgacttcatagtcccagacccaaagaaagct
gctgtgtgggaaatcacgggggctgagttctccaggtctgaggctcacacggccgatggg
atctccatccgattccctcgttgtacccggatccgtgacgataaggactggaaatctgcc
actaaccttccccagctcaaggaactgtaccagctgtccaaggagaaggcggacttcgct
gtggcggctggagaggagggaagctccaccacagggggcagcagcagcggcggagagaac
gggggtgtctcggggcctgctggggctagcaaggccaagaaggtgggagggaggccgagt
agccccaatgacagaggcggccacaagttgatagccaaaccttcccctgtgaaagtgggg
cagaagcggaaggctcccgatgaggcttcatgcccagcaaaggtgctgctggacatcttc
actggcgtgcggctctacctgccaccctctacgccagacttcagccgtctcagacgctac
tttgtggcattcgatggggacctggtgcaggaatttgacatggcatcagccacacatgtg
ctgggtagcggggacaagaaccctgaggctcagcaggtctccccggagtggatttgggcg
tgtatccggaaacgaaggctggtagctccctgctag

DBGET integrated database retrieval system