KEGG   Canis familiaris (dog): 491868Help
Entry
491868            CDS       T01007                                 

Gene name
SUV39H1
Definition
(RefSeq) histone-lysine N-methyltransferase SUV39H1
  KO
K11419  histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    491868 (SUV39H1)
Enzymes [BR:cfa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     491868 (SUV39H1)
Chromosome and associated proteins [BR:cfa03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     491868 (SUV39H1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    491868 (SUV39H1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET Chromo
Motif
Other DBs
NCBI-GeneID: 491868
NCBI-ProteinID: XP_548987
Ensembl: ENSCAFG00000015545
VGNC: 47001
UniProt: E2R289
LinkDB All DBs
Position
X
AA seq 412 aa AA seqDB search
MAENLKGCSVCCKSSWNQLQDLCRLAKLSCPALGISKRNLYDFEVEYLCDYKKIREQEYY
LVKWRGYPDSESTWEPRQNLKCVRILKQFHKDLERELLRRHQRSKPPRHLDPSLANYLVQ
KAKQRRALRRWEQELNAKRSHLGRITVENEVDLDGPPRAFVYINEYRVGEGITLNQVAVG
CECQDCLWAPAGGCCPGASLHKFAYNDQGQVRLRAGLPIYECNSRCRCGYDCPNRVVQKG
IRYDLCIFRTDDGRGWGVRTLEKIRKNSFVMEYVGEIITSEEAERRGQIYDRQGATYLFD
LDYVEDVYTVDAAYYGNISHFVNHSCDPNLQVYNVFIDNLDERLPRIAFFATRTIRAGEE
LTFDYNMQVDPVDMESTRMDSNFGLAGLPGSPKKRVRIECKCGTESCRKYLF
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaaatttaaaaggctgcagtgtgtgttgcaagtcgtcttggaatcagctacag
gacctgtgccgtctggccaagctctcctgccctgccctcggcatctccaagaggaatctc
tatgactttgaagtcgagtacctgtgtgattacaagaagatacgcgaacaagagtattac
ctggtaaaatggcgtggatacccagactcagagagcacctgggagccacggcagaatctc
aagtgtgtacgcattctcaagcagttccacaaggacttagaaagggagctgctccggcgg
caccagcgatcaaagcccccccggcacctggacccaagcttggccaactacctggtacag
aaagccaagcagaggcgggcgctccggcgctgggagcaggagctcaatgccaagcgcagc
cacctgggacgcatcactgtggagaatgaggtggacctggacggccccccgcgggctttt
gtatacatcaatgagtaccgtgttggtgagggcatcaccctcaaccaggtggcggtgggc
tgtgagtgccaggactgtctgtgggcccccgctggaggctgctgccctggggcatcgctg
cacaagtttgcctacaatgaccagggtcaggtgcggctgcgtgccgggctgcccatctac
gagtgcaactcccgctgccgctgtggctatgactgccccaaccgtgtggtacagaagggc
atccgctatgacctctgcatcttccgcacggatgacgggcgtggctggggcgtccgtacg
ctggagaagatccgcaagaacagtttcgtcatggagtacgtgggagagatcattacctca
gaggaggcggagcggcggggccagatctacgaccgccagggcgccacctacctcttcgac
ctggactacgtggaggacgtgtacaccgtggatgccgcctattatggcaacatctcccat
tttgtcaaccacagttgtgaccccaacctccaggtgtacaacgtcttcatagacaacctt
gatgagcgactgccccgcatcgctttctttgccacaagaaccatccgggcaggcgaggag
ctcacctttgattacaacatgcaagtggaccccgtggacatggagagcacccgcatggac
tccaactttggcctggccgggctccccggctcccccaagaagcgggtccgtattgaatgc
aagtgtgggactgaatcctgccgcaaatacctcttctag

DBGET integrated database retrieval system