KEGG   Canis familiaris (dog): 607662Help
Entry
607662            CDS       T01007                                 

Gene name
HDAC4
Definition
(RefSeq) LOW QUALITY PROTEIN: histone deacetylase 4
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04371  Apelin signaling pathway
cfa05034  Alcoholism
cfa05165  Human papillomavirus infection
cfa05169  Epstein-Barr virus infection
cfa05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    607662 (HDAC4)
 09160 Human Diseases
  09161 Cancers
   05203 Viral carcinogenesis
    607662 (HDAC4)
  09164 Substance dependence
   05034 Alcoholism
    607662 (HDAC4)
  09167 Infectious diseases
   05169 Epstein-Barr virus infection
    607662 (HDAC4)
   05165 Human papillomavirus infection
    607662 (HDAC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cfa03036]
    607662 (HDAC4)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     607662 (HDAC4)
Chromosome and associated proteins [BR:cfa03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     607662 (HDAC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl HDAC4_Gln
Motif
Other DBs
NCBI-GeneID: 607662
NCBI-ProteinID: XP_022265717
Ensembl: ENSCAFG00000012546
VGNC: 50629
LinkDB All DBs
Position
25
AA seq 1039 aa AA seqDB search
MADGLSGRDQPVELLNPARVNHMPSTVDVASALPLQVAPPAVPMDLRLDHQFALPVAEPT
LREQQLQQELLALKQKQQLQRQILIAEFQRQHEQLSRQHEAQLHEHIKQQQELLAMKHQQ
ELLEHQRKLERHRQEQELEKQHREQKLQQLKNKEKGKESAVASTEVKMKLQEFVLNKKKA
LAHRNLNHCISSDPRYWYGKTQHSSLDQSSPPQSGVSASYNHPVLGMYDTKDDFPLRKTA
SEPNLKLRSRLKQKVAERRSSPLLRRKDGPVVTALKKRPLDVTDSACSSAPGSAPSSPNN
SSGNVSAENGITPAVASIPAETGLAHRLVTREGSVAPLPLYTSPSLPNITLGLPATGPSA
GAAGQQDAERLALPALQQRIPLFPGTHLTPYLSTAPLERDGGAAHNPLLQHMVLLEQTPA
QTPLVTGLGALPLHAQPLVGADRVSPSMHKLRQHRPLGRTQSAPLPQNAPALQHLVIQQQ
HQQFLEKHKQHFQQQLHMNKIIPKQNEPARQPESHPEETEEELREHQALLEEPYLDRLSG
QKEAHALAGVQVKQEPIESDDEEAEPPREVEPGQRQPTEQELLFRQQALLLEQQRIHQLR
NYQASMEAAGIPVSFGGHRPLSRAQSSPASATFPMSVQEPPTKPRFTTGLVYDTLMLKHQ
CTCGNTNSHPEHAGRIQSIWSRLQETGLRGKCECIRGRKATLEELQTVHSEAHTLLYGTN
PLNRQKLDSKKLLGSLTSVFVRLPCGGVGVDSDTIWNEVHSSGAARLAVGCVVELVFKVA
TGELKNGFAVVRPPGHHAEESTPMGFCYFNSVAIAAKLLQQRLDVSKTLIVDWDVHHGNG
TQQAFYNDPNVLYISLHRYDDGNFFPGSGAPDEVGTGPGVGFNVNMAFTGGLDPPMGDAE
YLAAFRTVVMPIANEFAPDVVLVSSGFDAVEGHPTPLGGYNLSAKCFGYLTKQLMGLAGG
RIVLALEGGHDLTAICDASEACVSALLGNELDPLPEKVLQQRPNANAVRSMEKVIEIHSE
LCGPRARRGAPGVRDDPGH
NT seq 3120 nt NT seq  +upstreamnt  +downstreamnt
atggcagatggactttctggccgagaccagcccgtggagctgctaaaccctgcccgcgtg
aaccacatgcccagcacggtggatgtggcctccgcgctgcctctgcaggtcgcccccccg
gcggtgcccatggacctccgcctggaccaccagtttgcgctgcccgtggcggagcccacc
ctccgggagcagcagctgcagcaggagctactggccctcaagcagaagcagcagctccag
aggcagatcctcatcgccgagttccagaggcagcacgagcagctctcccggcagcacgag
gcccagctgcacgagcacataaaacaacagcaggagctgctggccatgaagcatcagcag
gagctgctcgagcaccagcggaagctggagaggcatcgccaggagcaggagctggagaag
cagcaccgggagcagaagcttcagcagctcaagaacaaggagaaaggcaaagagagtgcg
gtggccagcacggaagtgaagatgaagctgcaggagtttgtcctcaataaaaagaaggcg
ctggcccaccggaacctgaaccactgcatctccagcgacccccgctactggtacgggaaa
acacagcacagttcgctcgaccagagctccccaccccagagcggggtgtcggcctcctac
aaccacccggtcctgggaatgtacgacaccaaagatgacttcccgctcagaaaaacagct
tctgaacccaatttgaaactacggtccaggctaaagcagaaggtggccgagagacggagc
agccccctgctacgcagaaaagatgggccagtggtcaccgctctgaaaaagcgtccgctg
gacgtcacagactcggcgtgcagcagtgcccccggctccgctcccagctcccccaacaac
agctccgggaacgtcagcgcggagaacgggatcacacctgccgtggcgagcatcccggcc
gagaccggcttggcgcacagactcgtgactcgagaaggctccgtggccccgctccccctg
tacacgtcaccgtccctgcccaacatcacgctgggactgcccgccaccggcccttccgcg
ggggcggccggccagcaggacgccgagcgactcgctctcccggccctccagcagcggatc
cccctcttccccggcacccacctcactccctacctgagcacggcgcccctggagcgggac
ggcggggctgcgcacaaccccctcctgcagcacatggtcttactggagcagacgcctgca
cagacgcccctcgtcacaggcctgggcgcgctgcccctgcacgcgcagcctctggtgggt
gcggaccgcgtgtccccgtccatgcacaagctgcggcagcaccgcccgctggggcgcacc
cagtcggcgccgctgccccagaacgcgccggccctgcagcacctggtgatccagcagcag
caccagcagttcctggagaagcacaagcagcacttccagcagcagctgcacatgaacaag
attatccccaagcagaacgagccagcccggcagcccgagagccaccccgaggagacggag
gaggagcttcgcgagcaccaggccctcctggaggagccctacctggaccggctgtcgggg
cagaaggaggcgcacgccctggccggggtgcaggtgaagcaggagcccatcgagagcgac
gacgaggaggcggagcccccgcgggaggtggagccgggccagcgccagcccacggagcag
gagctgctcttcagacagcaagccctccttctggaacagcagcggatccaccagctgaga
aactaccaggcgtccatggaggccgctggcatccccgtgtcctttggcggccaccggcct
ctgtcgcgggcgcagtcctccccggcgtctgccaccttccccatgtctgtgcaggagccg
cccaccaaaccaaggttcaccacaggcctcgtgtacgacaccctgatgctgaagcaccag
tgtacctgcgggaacaccaacagccaccccgagcacgccggcaggatccagagcatctgg
tctcggctgcaggagacggggctccggggcaagtgtgagtgcatccgcggacggaaggcc
actctggaggagctgcagaccgtgcattcggaggcgcacaccctgctctacggcacaaac
cccctcaacaggcagaaactggacagtaagaaacttctaggctcgctaacgtcggtgttc
gtcaggctgccctgcggtggtgtcggggtggacagcgacaccatatggaacgaggtgcac
tcgtcgggggcggcgcgcctggccgtgggctgcgtggtggagctggtcttcaaggtggcc
accggggagctgaagaacggctttgccgtggtccgccctccaggacatcacgcggaggag
agcacgcccatgggcttctgctactttaattctgtggccatcgcagccaagcttctccag
cagcggctggacgtgagcaagaccctcatagtggactgggacgtgcaccacggaaatggg
acccagcaggccttctacaacgacccgaacgtcctgtacatctcccttcaccgctacgac
gacgggaacttcttcccgggcagcggggccccggacgaggtgggcacagggccaggtgtg
ggcttcaacgtcaacatggctttcactggtggccttgacccccccatgggagacgcggag
tacttggcagccttcaggaccgtggtcatgcccatcgcgaacgagtttgccccagacgtg
gtgctcgtgtcatcaggctttgacgctgtggagggccaccccacgcccctcggcggctac
aacctctccgccaaatgtttcgggtacctgacgaagcagctgatgggcttggctggcggc
cggatcgttctggccctggaggggggccacgacctcacggccatctgcgacgcctcggaa
gcatgtgtttctgctttgctgggcaatgagcttgatcctctcccagaaaaggttttacag
cagagacccaacgctaacgctgtccggtccatggagaaagtcattgagatccacagtgag
ttgtgtgggccacgtgctcggcggggagccccaggggtgagggatgacccaggtcactga

DBGET integrated database retrieval system