KEGG   Canis lupus familiaris (dog): 607724
Entry
607724            CDS       T01007                                 

Gene name
FGF1
Definition
(RefSeq) fibroblast growth factor 1 isoform X2
  KO
K18496  fibroblast growth factor 1
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa04010  MAPK signaling pathway
cfa04014  Ras signaling pathway
cfa04015  Rap1 signaling pathway
cfa04151  PI3K-Akt signaling pathway
cfa04390  Hippo signaling pathway
cfa04810  Regulation of actin cytoskeleton
cfa05200  Pathways in cancer
cfa05218  Melanoma
cfa05224  Breast cancer
cfa05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    607724 (FGF1)
   04014 Ras signaling pathway
    607724 (FGF1)
   04015 Rap1 signaling pathway
    607724 (FGF1)
   04390 Hippo signaling pathway
    607724 (FGF1)
   04151 PI3K-Akt signaling pathway
    607724 (FGF1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    607724 (FGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    607724 (FGF1)
  09162 Cancer: specific types
   05226 Gastric cancer
    607724 (FGF1)
   05218 Melanoma
    607724 (FGF1)
   05224 Breast cancer
    607724 (FGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cfa04052]
    607724 (FGF1)
   00536 Glycosaminoglycan binding proteins [BR:cfa00536]
    607724 (FGF1)
Cytokines and growth factors [BR:cfa04052]
 Growth factors
  Growth factors (RTK binding)
   607724 (FGF1)
Glycosaminoglycan binding proteins [BR:cfa00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   607724 (FGF1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 607724
NCBI-ProteinID: XP_013963577
Ensembl: ENSCAFG00000031965
VGNC: 52134
LinkDB
Position
2
AA seq 182 aa
MTQTALGEGLANGPGSLESTITSSCRAMAEGEITTFTALTEKFNLPPGNYMKPKLLYCSN
GGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQT
PNEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVS
SD
NT seq 549 nt   +upstreamnt  +downstreamnt
atgacgcagactgctctgggggaagggcttgctaacggcccaggcagccttgaaagcacc
ataaccagcagctgcagagccatggctgaaggggaaatcacaaccttcactgccctgacg
gagaagtttaatctgcctccggggaattacatgaagcccaaactcctctactgtagcaac
gggggccacttcctgaggatccttccagatggcacagtggatgggacaagggacaggagc
gaccagcacattcagctgcagctcagcgcggaaagcgtgggggaggtgtatataaagagc
accgagactggccagtacttggccatggacaccgatgggcttctgtacggctcacagaca
ccgaatgaggaatgtttgttcctggaaaggctggaggaaaaccattacaacacctacaca
tccaagaagcatgcagaaaaaaattggtttgttggtctcaagaagaatggaagctgcaaa
cgcggtcctcggactcactatggtcaaaaagcaattttgtttctccccctgccagtgtcc
tctgattaa

DBGET integrated database retrieval system