KEGG   Canis lupus familiaris (dog): 607929
Entry
607929            CDS       T01007                                 

Gene name
RASSF1
Definition
(RefSeq) ras association domain-containing protein 1 isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa04014  Ras signaling pathway
cfa04390  Hippo signaling pathway
cfa04392  Hippo signaling pathway - multiple species
cfa05200  Pathways in cancer
cfa05206  MicroRNAs in cancer
cfa05219  Bladder cancer
cfa05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    607929 (RASSF1)
   04390 Hippo signaling pathway
    607929 (RASSF1)
   04392 Hippo signaling pathway - multiple species
    607929 (RASSF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    607929 (RASSF1)
   05206 MicroRNAs in cancer
    607929 (RASSF1)
  09162 Cancer: specific types
   05219 Bladder cancer
    607929 (RASSF1)
   05223 Non-small cell lung cancer
    607929 (RASSF1)
SSDB
Motif
Pfam: RA Nore1-SARAH C1_1
Other DBs
NCBI-GeneID: 607929
NCBI-ProteinID: XP_005632562
Ensembl: ENSCAFG00000010627
VGNC: 45378
LinkDB
Position
20
AA seq 340 aa
MSTEPELIELRELEPARRGGPGRSRLERANALRIAPGTARNPARQLVAGRGHHFQPAGPA
THTWCDLCGDFIWGVVRKGLQCAHCKFTCHYRCRALVCLDCCGPRDLGWEPALERDTNVD
EPAEWEIPDLSQAEVEQKIKEYNSQINSNLFMSLNKDGSYTGFIKVQLKLVRPVSVPSSK
KPPSLQDVRRGPGRGTAVKRRTSFYLPKDAVKHLHVLSRTRAREVIEALLRKFLVVDDPR
KFALFERAERHGQVYLRKLSDDEQPLRLRLLAGPSEKALSFVLKENDSGEVNWDAFSMPE
LHNFLRILQREEEEHLRQILQKYSYCRQKIQEALHACPLG
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgtccaccgaacccgagctcattgaactgagggaactggagcccgcgcggcgcggaggt
ccgggccgcagccggctggagcgagcgaacgcgctgcgcatcgcaccggggaccgcgcgc
aatccggcacggcagctggtcgcgggccgcggccaccacttccaacctgcggggcccgcc
acgcacacgtggtgcgacctctgcggcgacttcatctggggcgtcgtgcgcaagggcctg
cagtgcgcgcattgcaagttcacatgccactaccgttgccgcgcgcttgtctgcctggac
tgctgcgggccccgggacctgggctgggaacctgcgctggagcgggacacgaacgtggat
gagcctgcggagtgggagatacctgacctttctcaggctgaggttgagcagaagataaag
gaatacaatagccagatcaacagcaacctcttcatgagcctgaacaaggatggctcctac
acaggcttcatcaaggttcaactgaagctggtgcgccctgtctcagtgccctccagcaaa
aagccaccgtccttgcaggatgtgaggcggggcccagggcgaggcacagctgtgaagcgt
cgcacctccttctacctgcccaaggatgctgtcaagcacctgcatgtgttgtcacgcacg
cgggcacgtgaggtcattgaggccctacttcgcaaattcttggtggtggatgacccccgc
aagtttgcactctttgagcgggctgagcgccatggccaagtgtacctccggaagctgtcg
gatgatgaacagcccctgcgtctgcggctccttgcagggcccagcgagaaggccctaagc
tttgtcctcaaggagaatgactctggggaggtgaattgggatgcctttagcatgcctgaa
ctacacaacttcctgcgcatccttcagcgggaggaagaggagcacctccgccagatcctg
caaaagtactcttattgccgtcagaagatccaggaagcccttcacgcctgccccctgggg
tga

DBGET integrated database retrieval system