KEGG   Canis lupus familiaris (dog): 609293
Entry
609293            CDS       T01007                                 

Gene name
IL3RA
Definition
(RefSeq) interleukin-3 receptor subunit alpha isoform X1
  KO
K04737  interleukin 3 receptor alpha
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa04060  Cytokine-cytokine receptor interaction
cfa04151  PI3K-Akt signaling pathway
cfa04210  Apoptosis
cfa04630  JAK-STAT signaling pathway
cfa04640  Hematopoietic cell lineage
cfa05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    609293 (IL3RA)
   04151 PI3K-Akt signaling pathway
    609293 (IL3RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    609293 (IL3RA)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    609293 (IL3RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    609293 (IL3RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    609293 (IL3RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:cfa04050]
    609293 (IL3RA)
   04090 CD molecules [BR:cfa04090]
    609293 (IL3RA)
Cytokine receptors [BR:cfa04050]
 Interleukin receptor families
  IL3 receptor family
   609293 (IL3RA)
CD molecules [BR:cfa04090]
 Proteins
  609293 (IL3RA)
SSDB
Motif
Pfam: IL3Ra_N IL6Ra-bind EpoR_lig-bind
Other DBs
NCBI-GeneID: 609293
NCBI-ProteinID: XP_005641117
Ensembl: ENSCAFG00000011047
LinkDB
Position
X
AA seq 426 aa
MALLWLAVLVMSVCLLRSEKDPDSPIKNLRMEPGSRRLTWDLSGNVSEIKCFINSKYITK
AIDSRYCQFYVLPLCEVKNFTISVKQDPPFSTGLQYVPRGAEGKPAAAARGLDCWVHDVD
FLTCSWEVGRAAPGDVQYRLYWRDLKAYREQECPRYEANNRGVHVRCRFDDVSRLQRHIQ
FWVNGTSRRSGIPCSDLCVELPEIERLSPPHITATCNKSYSMMEWKVLSHFNHRFLYELQ
IQKGTDPASTEKLYENHFVIYNPGNYVAKLKVQGFFRKDWSEWSAPQLFVCDPKDEHRRD
WLVSVLVLLGTLLVLGLVALLCRSFAETLPSHPSHEGPHHGQPPEPQAGALGHQQSQPGG
LSGGRGAHFGGNMKRDLRRPSPIGQEPGGGSPEERSGLGREHLCQAHRVNKGLLHPVPEL
RGGGSR
NT seq 1281 nt   +upstreamnt  +downstreamnt
atggccttgctgtggctcgcggtgcttgtgatgtctgtctgtctgctgcgctccgagaaa
gatccagattcaccgattaagaacctcaggatggagccgggaagcaggagactgacctgg
gacctcagtggaaatgtctctgaaattaagtgtttcatcaactcaaaatatatcactaag
gccatcgacagccgttactgccagttttatgtgcttcccttatgtgaagtgaaaaacttc
accatctccgtgaagcaagacccgccgttctccacggggcttcagtacgtcccgcgaggt
gcagaaggaaagccggcggcggccgcgcggggcctggactgctgggtgcacgacgtggac
ttcctgacgtgcagctgggaggtgggcagggcggcccccggcgacgtgcagtaccgcctg
tactggcgggacctgaaggcctaccgcgagcaggagtgtccgcgatacgaggcgaacaat
cggggcgtccacgtccggtgccggttcgatgacgtgtccaggttgcagaggcacatccag
ttctgggtgaacggcaccagccgacgctccggaatcccttgctccgacctctgtgtcgaa
ttaccggaaatcgagagattaagtccaccccacatcactgcaacgtgtaataaatcctat
tcaatgatggagtggaaagtattaagccacttcaatcacagatttctgtatgaacttcaa
atacaaaagggcaccgatcctgcgtccacggagaagctctacgaaaaccacttcgtgatt
tacaatcccggaaactacgtggcgaaactaaaggtgcagggtttcttccgcaaagactgg
agcgaatggagcgccccccaactctttgtgtgtgaccccaaggatgagcaccgccgtgac
tggctggtgtcagtactggtcttgctggggacactgctggtcctgggactcgtggccctg
ctgtgtagaagttttgcagaaactcttccctcccatccctcacatgaaggaccccatcac
ggacaacctccagagccccaagctggagcactgggacaccagcagagccagccaggagga
ctgtccggtggccgaggtgcacattttgggggaaacatgaagcgggacctcagacgtcct
tccccgattggccaggagcccggaggagggagcccggaggagcgtagtgggctggggagg
gaacacctgtgtcaggctcatcgtgtaaataaaggcctcttgcacccagtccctgaactc
cggggagggggatccagatag

DBGET integrated database retrieval system