KEGG   Canis familiaris (dog): 609435Help
Entry
609435            CDS       T01007                                 

Gene name
BRD9
Definition
(RefSeq) bromodomain-containing protein 9
  KO
K22184  bromodomain-containing protein 9
Organism
cfa  Canis familiaris (dog)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cfa03036]
    609435 (BRD9)
Chromosome and associated proteins [BR:cfa03036]
 Eukaryotic type
  Chromatin remodeling factors
   Other chromatin remodeling factors
    609435 (BRD9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF3512 Bromodomain TFIIF_alpha NPR3
Motif
Other DBs
NCBI-GeneID: 609435
NCBI-ProteinID: XP_013965798
Ensembl: ENSCAFG00000010863
VGNC: 49718
LinkDB All DBs
Position
34
AA seq 626 aa AA seqDB search
MKGRKQWLLWGPGFLSTDYTDKPLEKPLKLVLKVGGSEVTELSGSGHDSSYYDDRSDHER
ERHKEKKKKKKKKSEKEKHLDDEERRKRKVEPGTQRPEEKKRKREKEHGDTEGETDDFEP
GKKVEVEPPPDRPVRACRTQPAENESTPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPG
YSMIIKHPMDFGTMKDKIVANEYKSVTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHA
GFKMMSKERLLALKRSMSFMQDMDFSQQAALLGNEDTAVEEPVPEVAPVQVETAKKSKRP
SREVISCMFEPEGNACSLTDSTAEEHVLALVEHAADEARDRINRLLPGGKMGYLRKNGDG
SLLYSVVNTAEPDADEEETHPVDLSSLSSKLLPGFTTLGFKDERRGKVTFLSSATTALSM
HNNSVFGDLKSDETELLYSAYGDETGVQCALSLQEFVKDAGSYSKKMVDDLLDQITGGDH
SRMLFQLRQRRNVPVKPPDEVKAGDSLGDGSSVLDFMAMKSYSDASLDISMLGSLGKVKK
ELDADDGHLNLDETAKLLQDLHEAQAERGGSRPSSNLSSLSNTSPSDRDQHHLGSPSRLS
VGEQPEVTHDPYEFLQSPEPAASTKS
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgaaggggaggaaacagtggctgctctggggccccgggtttctgtccacagattacaca
gacaaacctctggagaagcccctgaagctggttctcaaagtcggaggaagtgaagtgact
gagctctcggggtctgggcacgattccagttattatgatgacaggtcagaccacgagcga
gagcggcacaaagagaagaagaagaagaagaaaaagaaatcagagaaggagaagcacctg
gacgacgaagaaagaaggaaaagaaaggtagagccagggacacagcggcctgaagagaag
aagcggaagcgggaaaaggagcatggcgacacagagggagagaccgatgactttgaacct
gggaagaaggtggaggtggagccgccccccgataggcccgttcgagcgtgccgaacacag
ccagctgagaatgagagcacacctattcaacaactattagagcattttcttcgccagctc
cagagaaaagatcctcatgggttttttgcttttcctgtcacggatgcaattgctccagga
tactcaatgataataaaacatcccatggattttggcacaatgaaagacaagattgtagcc
aacgaatacaagtcagtcacggaatttaaggcagattttaaactgatgtgtgataacgcc
atgacctacaacagaccagacactgtgtattacaagttagccaagaagatccttcatgca
ggctttaagatgatgagcaaagagcggctgttagctttgaagcgcagcatgtcgtttatg
caggacatggatttttctcagcaggcagctcttctgggcaatgaagatacagctgtcgag
gaacccgtccccgaagtggcacctgtacaagtagaaactgccaagaaatccaaaaggccg
agtagagaagttatcagctgcatgtttgagccggaaggaaatgcttgcagcctgactgac
agcacggcggaggagcacgtgctggccttggtggagcacgcagctgacgaggctcgggac
aggatcaaccggctcctcccagggggcaagatgggttatctgaggaagaatggggacggc
agcctcctctacagcgtggtcaacacggctgagccggacgctgatgaggaggagacccac
ccggtggacctaagctcactctccagcaagctgctgcccggcttcaccacgctgggcttc
aaagatgagagaaggggcaaagtgacgtttctctccagtgccactactgcactttccatg
cacaacaattcagtatttggcgacttgaaatcggacgaaacggagctgctttattctgcc
tatggggatgagacgggtgtgcagtgcgcgctgagcctgcaggaatttgtgaaggatgct
gggagctatagcaagaaaatggtggatgacctcctggaccagatcaccggtggggaccac
tcacgaatgctcttccagctgaggcagaggagaaatgttccagtgaagcctccagacgaa
gtgaaggctggggactcgctgggcgacggcagctctgttctggacttcatggcgatgaag
tcctactctgacgcctctctggatatctccatgcttggctctctggggaaagtgaagaag
gagctggatgctgacgacggccacctgaacttggatgagacagcaaagctcctgcaggac
ctgcacgaggcacaggcagagcgtgggggctcccggccgtcctccaacctcagctccctg
tccaacacctccccctctgacagggaccagcaccacctgggaagcccttctcgcctcagt
gttggggagcagccagaggtgacccatgacccgtacgagtttctgcagtctccggaacct
gcagcctctacgaagagctag

DBGET integrated database retrieval system