KEGG   Canis familiaris (dog): 609914Help
Entry
609914            CDS       T01007                                 

Gene name
GPT
Definition
(RefSeq) alanine aminotransferase 1
  KO
K00814  alanine transaminase [EC:2.6.1.2]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00220  Arginine biosynthesis
cfa00250  Alanine, aspartate and glutamate metabolism
cfa01100  Metabolic pathways
cfa01200  Carbon metabolism
cfa01210  2-Oxocarboxylic acid metabolism
cfa01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    609914 (GPT)
   00220 Arginine biosynthesis
    609914 (GPT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cfa01007]
    609914 (GPT)
Enzymes [BR:cfa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     609914 (GPT)
Amino acid related enzymes [BR:cfa01007]
 Aminotransferase (transaminase)
  Class I
   609914 (GPT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 609914
NCBI-ProteinID: XP_022282224
VGNC: 41460
LinkDB All DBs
Position
13
AA seq 491 aa AA seqDB search
MVKGHDSGPELPRCPRALRRPGAALPWPPAPQPSGSGPHHLLTGDQRPSRAPVACGLSQE
GFPSPIRPGFYRGLASYLGDRPLAHAKMGGLRGLSLGRALLGIMALRAGDQVAMNGLKEK
VLTLDTMNPCVRRVEYAVRGPIVLRALELEQELRQGVKKPFTEVVRANIGDAQAMGQKPI
TFLRQVLALCVHPDLLNSPDFPEDAKRKAERILQACGGHSLGAYSVSSGIQLIREDVAEY
IERRDGGIPSDPNNIYLSTGASDAIVTVLKLLVAGEGPTRTGVLIPIPQYPLYSAALAEL
NAVQVDYYLDEERTWALDVAELRRALCQARAHCRPRALCVINPGNPTGAPPVAPICSRPP
PPPTPPHPPWPQERQAVLAELAAKAKLTEQVFNESPGIRCNPVQGAMYSFPRVQLPPRAV
QRAQELSLAPDMFFCMRLLEETGICVVPGSGFGQREGTYHFRMTILPPMEKLRPLLEKLS
QFHAKFTREYS
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaagggcacgacagcggcccagagctgccgaggtgtcccagggccctccgaagg
cccggagctgccctaccctggcccccggcaccccaacccagcggctctggcccccaccac
ttgctgactggggaccaacgtccaagcagggctcctgtggcctgcgggctgtcgcaggag
gggttcccctcccccataaggccaggattctatagaggcctggccagttacctgggagac
aggccgctggcccacgctaagatggggggcctgagagggctcagccttggcagagccctg
ctggggatcatggccttgagggcaggtgaccaggttgcaatgaacgggctgaaggagaag
gtgctgacgctggacaccatgaacccgtgtgtgcggagggtggagtatgccgtgcgcggt
cccattgtgctgcgtgccctcgagctggagcaggagctgcgccagggagtgaagaagccc
ttcactgaggtcgtccgcgccaacattggggatgcacaggccatggggcagaagcccatc
accttcctacgtcaggtcctggccctctgcgtccacccggatctcctgaacagcccggac
ttccccgaggatgccaagaggaaggcggagcgcatcttgcaggcatgtgggggacacagc
ctgggggcctacagcgtcagctccggcatccagctgatccgcgaggacgtggctgagtac
attgagcggcgggacggaggcattccctcggaccccaacaacatctacctgtccactggg
gccagcgacgccatcgtgacggtgctgaagctgctggtggccggagagggccccacccgc
acaggggttctcatccccatcccgcagtacccgctgtactcggctgctctggccgagctc
aacgcggtgcaggtggactactacctggatgaggagcgcacctgggcgctcgacgtggcc
gagctgcggcgcgccctgtgccaggcgcgggctcactgccgcccccgcgcactgtgcgtt
atcaaccctggcaaccccaccggtgcgccgcccgtcgccccaatttgttcccggcccccc
ccaccccccacccccccccaccccccgtggccgcaggagaggcaggcggtgctggcggag
ctggcggcaaaggcgaagctcacggagcaggtgttcaacgagtccccgggcatccgctgc
aacccggtgcagggcgccatgtactccttccctcgcgtgcagctgcccccccgcgccgtg
cagcgcgctcaggaattgagcctggcccccgacatgttcttctgcatgcgcctcctggag
gagaccggcatctgcgtggtgcccggcagcggcttcgggcagagggaaggcacctaccac
ttccggatgaccattctgccccccatggagaagctgcggcctctgctggagaagctgagc
cagttccacgccaagttcacccgagagtactcctga

DBGET integrated database retrieval system