KEGG   Canis familiaris (dog): 610615Help
Entry
610615            CDS       T01007                                 

Definition
(RefSeq) N-lysine methyltransferase KMT5A isoform X4
  KO
K11428  histone-lysine N-methyltransferase SETD8 [EC:2.1.1.43]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    610615
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cfa03036]
    610615
Enzymes [BR:cfa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     610615
Chromosome and associated proteins [BR:cfa03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     610615
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 610615
NCBI-ProteinID: XP_005636176
Ensembl: ENSCAFG00000007484 ENSCAFG00000007493
VGNC: 42493
LinkDB All DBs
Position
26
AA seq 295 aa AA seqDB search
MSPNKCSGMRSPLQEENSVAHHEVKCQGKPLAGLCRKREEKRNSGNAVRSAMKSEEQKLK
DARRGPLAPFPNQKSEAAEPPKTPTSSCDPPITAIAKQALKKPIKGKQAPRKKAQGKTQQ
NRKLTDFYPVRRSSRKSKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFS
RGEFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLI
NHSKCGNCQTKLHDIDGVPHLILIASRDIKAGEELLYDYGDRSRASIEAYPWLKH
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgagccccaacaaatgctctggaatgcgttccccccttcaggaagagaactcagttgca
catcacgaagtcaaatgccaggggaagccattagctggactctgcaggaaacgagaagag
aaaagaaacagtgggaacgcagtacggagcgccatgaagtctgaggaacagaagctcaaa
gacgccaggagaggtcccctggcaccttttccaaaccaaaaatctgaagcagcagaacct
ccaaaaactccgacctcgtcttgtgatcctcccattacggctatcgccaagcaagccctg
aagaagcccatcaagggcaaacaggctcctcggaaaaaagctcaaggaaaaacacaacag
aatcgcaaactcacggatttctaccccgtgcgaaggagctccaggaagagcaaagctgag
ctgcagtctgaagaaaggaaaagaatagacgagttgattgaaagtgggaaggaagaagga
atgaagattgacctcattgatggcaagggcaggggtgtgatcgccaccaagcagttctcc
cggggcgagtttgtggtagagtaccacggggacctcatcgagatcaccgatgccaagaag
cgggaggctttgtatgcacaagacccctccacgggctgctacatgtactattttcagtat
ctgagcaaaacctactgcgtggatgcaactagagagacaaatcgcctgggaagactgatc
aatcacagtaaatgtgggaactgccaaaccaaactgcacgacattgacggcgtgcctcac
ctcatcctcatcgcctcccgagacatcaaggctggggaggaactcctgtacgactatggg
gatcgcagccgggcttctatcgaagcgtacccctggctgaagcattag

DBGET integrated database retrieval system