KEGG   Canis familiaris (dog): 610668Help
Entry
610668            CDS       T01007                                 

Gene name
ACE
Definition
(RefSeq) LOW QUALITY PROTEIN: angiotensin-converting enzyme
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04614  Renin-angiotensin system
cfa04924  Renin secretion
cfa05142  Chagas disease (American trypanosomiasis)
cfa05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    610668 (ACE)
   04614 Renin-angiotensin system
    610668 (ACE)
 09160 Human Diseases
  09165 Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    610668 (ACE)
  09167 Infectious diseases
   05142 Chagas disease (American trypanosomiasis)
    610668 (ACE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cfa01002]
    610668 (ACE)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cfa04147]
    610668 (ACE)
   04090 CD Molecules [BR:cfa04090]
    610668 (ACE)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     610668 (ACE)
Peptidases [BR:cfa01002]
 Metallo Peptidases
  Family M2
   610668 (ACE)
Exosome [BR:cfa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   610668 (ACE)
CD molecules [BR:cfa04090]
 Proteins
  610668 (ACE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-GeneID: 610668
NCBI-ProteinID: XP_003639297
Ensembl: ENSCAFG00000012998
LinkDB All DBs
Position
9
AA seq 1315 aa AA seqDB search
MGAAPGRPGRGPLPLPLPLLLLLPLLLPPPPPPAALALDPELQPGNFAADEAGAQLFVQS
FNSSAELVMYQSTVASWAYDTNITEENARRQEEAALLNQEFAEVWGQKAKELYDPIWQNF
SDPVLRRVISGVRTLGPANLPVEKRQQYNALLSNMNRIYSTARVCFYPNKTAICWSLDPE
LTHIMAISRNYALLLYAWEGWHNAVGTPLKPLYQNFTVLSNEAYQKDGFSDTGAYWRSWY
ESPTFVEDLEHLYHQVEPLYLNLHAYVRRALHRRYGDRYINLRGPIPAHLLGDMWAQSWD
NLYDMMVPFPDKPSLDVTSTMVRKGWNTTHMFRVAEEFFTSLGLSPMPPEFWAGSMLEKP
TDGREVVCHASAWDFYNRRDFRIKQCTRVTMDQLSTVHHEMGHVQYYLQYKEQPVSLRQG
ANPGFHEAIGDVLALSVSTPAHLYKIGLLDNVSNDIESDINFLLKMALEKIAFLPFGYLV
DQWRWGVFSGRTPPSRYNFDWWYLRTKYQGICPPVARNETHFDAGAKFHVPNVTPYIRYF
VSFVLQFQFHQALCKEAGHQGPLHTCDIYQSTQAGAKLREALRAGSSRPWQDVLREAIGS
DTLDAQPLLDYFQPVSRWLQEQNKRNGEVLGWPEYQWRPPMPNNYPQDIGLVTDEVEARR
FVEEYDRRSLVIWNEYAEANWNYNTNITTETSKILLQKNIQMANHTFKFGTWARQFDVTN
FQNASIKRMIKKIQDLERAALPAKELEEYNKILLDMETTYSVASVCHTNGTCLQLEPDLT
NLMATSRKYEDLLWAWKSWREKVGRAILPFFPKYVELANKAARLNGYEDAGDSWRAMYEM
PSLEQDLEQLYQELQPLYLNLHAYVRRALHRHYGPQHINLEGPIPAHLLGNMWGQTWSNI
YDLVVPFPSAPKIDATEAMIKQGWTPKRMFEEANNFFTSLGLLPVPFEFWNKSMLEKPTD
GREVVCHASAWDFYNGKDFRIKQCTTVNMEDLVVAHHEMGHIQYFMQYKDLPVTFREGAN
PGFHEAIGDVLALSVSTPKHLHSINLLSSESGGYEQDINFLMKMALDKIAXVPFSYLVDQ
WRWRVFDGSITKENYNQEWWNLRLKYQGLCPPVARSQGDFDPGAKFHVPSSVPYIRYFVG
FVIQFQFHEALCQAAGHKGPLHTCDIYQSKEAGKRLEDAMKLGFSKPWPEAMKLITGQSN
MSASAMMNYFKPLLDWLLTENGRHGEKLGWPQYNWTPNSARSEGPLPGTGRVNFLGLDLE
EQQARVGQWVLLFLGVALLVATLGLTQRLFSIRHHSLRRPHRGPQFGSEVELRHS
NT seq 3948 nt NT seq  +upstreamnt  +downstreamnt
atgggggccgcgccgggccgtcccgggcgggggccgctgccgctgccgctgccgctgctg
ctgctgctgccgctgctcctgccgccgccgccgccgcccgccgccctggcgctcgacccc
gagctgcagcccggaaactttgccgccgacgaggccggggcgcagctcttcgtgcagagc
ttcaactcgagcgccgagctggtgatgtaccagagcacggtggccagctgggcgtacgac
accaacatcaccgaggagaacgcgcggcgccaggaggaagcggccctgctcaaccaggag
tttgctgaggtctggggccagaaggccaaggagctgtatgacccgatctggcagaacttc
agcgacccagtcctgcgaagagtcatcagtggtgtgcgcaccctgggccctgccaacctg
cctgtggagaagcgtcagcagtacaacgctctgctgagcaacatgaacaggatctattcc
acagccagggtctgcttctaccccaacaagactgccatctgctggtccctggacccagag
ctcacccacatcatggccatctcaagaaactacgccctgctgctctatgcctgggagggc
tggcacaatgctgtgggcaccccgctgaagcccctgtaccagaacttcactgtcctcagc
aatgaggcctaccagaaggatggcttctcagacacaggggcctactggcgctcctggtat
gagtcgcctaccttcgtggaggatctggagcacctctaccatcaagtagagcccctctac
ctgaacctccacgcctacgtccgccgcgcactgcaccgccgatatggagacagatacatc
aacctcaggggacccatcccggctcacctgctgggggacatgtgggcccagagctgggac
aacctctatgacatgatggtgcctttccccgacaagcccagtctcgatgttaccagcact
atggtgcgcaagggttggaacactacgcacatgttccgggtggcagaggagttcttcacc
tccctagggctctcgcccatgcctcctgagttttgggcagggtccatgctggagaaacca
accgacgggcgtgaggtggtgtgccatgcctctgcctgggacttctacaacaggagagac
ttcaggatcaagcagtgcacgcgggttacgatggaccagctgtccacggtgcaccacgag
atgggccatgtgcaatactatctgcagtacaaagagcagcctgtctccctgcgccaaggg
gccaaccccggcttccatgaggccatcggggatgtgttggcgctctccgtctccactcct
gcacatctttacaaaattggcctgctggacaatgtcagcaatgacatagaaagtgacatc
aatttcttgttaaagatggcactggaaaaaattgccttcctgcccttcggctacttggta
gaccagtggcgttggggggtctttagtgggcgtacccccccttcccgctacaactttgac
tggtggtatcttcgaaccaagtatcaggggatctgtcctccagttgcccgaaatgaaacc
cactttgacgccggagctaagtttcacgtcccaaatgtgacaccatacatcaggtacttc
gtcagttttgtcctgcagttccagttccatcaagccctgtgcaaggaggcaggccaccag
ggcccgctgcacacgtgtgacatctaccagtccacccaggcgggggccaagctccgggag
gcactgcgggcaggctcctcaaggccctggcaggacgtgctcagggaggcgattggctca
gacaccctggacgctcaaccactgctcgactacttccagcccgtcagccgatggctgcag
gagcagaacaagcgcaacggcgaggtgctgggatggccagaataccagtggcggccaccg
atgcccaacaattacccacaggacattggcctggtgaccgatgaagttgaggccagaagg
tttgtggaggaatatgaccggagatcgctcgtgatatggaatgaatatgctgaggctaac
tggaactataacaccaatatcaccacagagaccagcaagatcctgctgcagaagaacata
cagatggcaaaccacaccttcaagtttggcacctgggccaggcagtttgacgtgactaac
ttccaaaatgcgagcatcaagcggatgataaagaaaattcaggacctagaacgggcagca
ctccctgccaaggagctggaagagtacaacaagatcctgctggacatggaaaccacttac
agcgtggcctctgtgtgccacaccaacggcacttgtctgcagctggagcctgatctgacg
aatctgatggccacatcccggaaatatgaagatctgctgtgggcctggaagagctggcga
gaaaaagtggggagagcaatcctcccttttttccccaagtacgtggaacttgccaacaag
gctgcccggctcaacggctacgaagatgcaggtgactcctggagagccatgtatgagatg
ccgtccctggagcaagacctggagcagctttaccaggagctgcagccactctacctgaac
ctccacgcctacgtgcgccgggccctgcaccgccactacgggccccagcacatcaacctg
gagggccccattccagctcacctgctggggaacatgtggggtcagacgtggtccaacatc
tatgacttggtggtacccttcccttcagcccccaagatagatgccacagaggccatgata
aagcagggctggactcccaaaaggatgtttgaagaagcgaacaatttcttcacctccctg
gggctgttgcctgtgccctttgagttctggaataagtcaatgctggagaagccgactgat
gggcgggaagtagtgtgccatgcctccgcctgggacttctacaatggcaaggacttcagg
atcaagcagtgcaccactgtgaacatggaggacctggtggtggcccatcacgagatgggc
cacatacagtatttcatgcagtacaaggacttgcctgtgaccttccgggagggcgccaac
cctggctttcatgaggccattggagatgtgctggcactctccgtgtctacccccaagcac
ctccacagcatcaacctgctgagtagcgagagcggtggctacgagcaagacatcaatttt
ctaatgaagatggcgcttgacaagatcgccnttgtgcccttcagctacctggttgaccag
tggcgctggagggtatttgatggaagcatcaccaaggagaactacaaccaggagtggtgg
aacctcaggctgaagtaccagggcctctgccccccagtggcccgttctcaaggggacttt
gacccaggggccaagttccatgttccttcaagtgtgccttatatcaggtactttgttggc
tttgtcattcagttccaattccatgaggctctgtgtcaggcagctggccataagggcccc
ttgcacacgtgtgacatctaccaatctaaggaggccgggaagcgcctggaggatgccatg
aaactgggcttcagtaagccgtggccggaagccatgaagctgatcacgggccagtccaac
atgtctgcatcagccatgatgaactacttcaagccgctgctggactggctgctcacggag
aacgggcggcacggggagaagctgggctggcctcagtacaactggacgcccaactctgct
cgctccgaaggccccttaccgggcaccggccgcgtcaacttcctgggcctggatctggag
gagcagcaggcccgcgtgggccagtgggtgctgctcttcctgggcgtcgccctgctggtg
gccaccttgggcctcacccagcggctcttcagcatccgccaccacagcctccgccggccc
caccgagggccccagtttggctccgaggtggagctgagacactcctga

DBGET integrated database retrieval system