KEGG   Canis familiaris (dog): 610941Help
Entry
610941            CDS       T01007                                 

Gene name
ALDH2
Definition
(RefSeq) aldehyde dehydrogenase, mitochondrial isoform X1
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00010  Glycolysis / Gluconeogenesis
cfa00053  Ascorbate and aldarate metabolism
cfa00071  Fatty acid degradation
cfa00280  Valine, leucine and isoleucine degradation
cfa00310  Lysine degradation
cfa00330  Arginine and proline metabolism
cfa00340  Histidine metabolism
cfa00380  Tryptophan metabolism
cfa00410  beta-Alanine metabolism
cfa00561  Glycerolipid metabolism
cfa00620  Pyruvate metabolism
cfa01100  Metabolic pathways
Module
cfa_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    610941 (ALDH2)
   00053 Ascorbate and aldarate metabolism
    610941 (ALDH2)
   00620 Pyruvate metabolism
    610941 (ALDH2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    610941 (ALDH2)
   00561 Glycerolipid metabolism
    610941 (ALDH2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    610941 (ALDH2)
   00310 Lysine degradation
    610941 (ALDH2)
   00330 Arginine and proline metabolism
    610941 (ALDH2)
   00340 Histidine metabolism
    610941 (ALDH2)
   00380 Tryptophan metabolism
    610941 (ALDH2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    610941 (ALDH2)
Enzymes [BR:cfa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     610941 (ALDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh HetR_C
Motif
Other DBs
NCBI-GeneID: 610941
NCBI-ProteinID: XP_013963474
Ensembl: ENSCAFG00000008683
LinkDB All DBs
Position
26
AA seq 538 aa AA seqDB search
MLRAAALAAAGLRPRLGRRLLSAASSQAVPAPNQQPEVFYNQIFINNEWHDAVSKKTFPT
INPSTGEVICQVAEGDKEDVDKAVKAARAAFQLGSPWRRMDASDRGRLLNRLADLIERDR
TYLAALETLDNGKPYVISYLVDLDMVLRCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPV
GVCGQIIPWNFPLLMQAWKLGPALATGNVIVMKVAEQTPLTALYVANLIKEAGFPPGVVN
IIPGFGPTAGAAIASHEDVDKVAFTGSTEVGHLVQVAAGNSNLKRVTLELGGKSPNIIMS
DADMNWAVEQAHFALFFNQGQCCCAGSRTFVQEDVYAEFVERSVARAKSRVVGNPFDSQT
EQGPQVDETQFKKILGYIKSGKEEGAKLLCGGGAAADRGYFIQPTVFGDVQDTMTIAKEE
IFGPVMQILKFKTIEEVIGRANNSKYGLAAAVFTKDLDKANYLSQALQAGTVWINCYDVF
GAQSPFGGYKMSGSGRELGEYGLQAYTEVKTGLFKQYILLEHFHLDCTQAVISNSWLL
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgcgccgccgcgctcgctgccgccggcctccggccccgcctgggccgccgcctc
ctgtcggccgcctcctcccaggccgtgccggcccccaaccagcagcccgaggtcttctac
aaccagatcttcataaacaatgagtggcacgatgctgttagcaagaaaacgttccccacc
atcaatccatccactggagaagtcatctgtcaggtagctgaaggagataaggaagatgtg
gacaaggcagtaaaggctgcccgggctgccttccagctaggttcaccctggcgccgcatg
gacgcatctgacagaggccgcttgctgaaccgcctggcagatctgattgagcgagaccgg
acctatctggcagccttggagaccctggataatggcaagccctatgtcatctcttacctt
gtggatctggacatggtcctcagatgcctccgttactatgctggctgggctgataagtac
catgggaaaaccattcctatcgatggggactttttcagttatacccgccatgaacctgtc
ggggtgtgcgggcagatcattccatggaacttccccctcctgatgcaagcctggaaactg
ggcccagctctggcgaccggaaatgtgattgtgatgaaggtagctgagcagactccactc
actgccctgtatgtggccaacctgattaaggaggctggctttcctcctggcgtggtcaat
attattcctggatttggccccacagctggggctgccatcgcctcccacgaggatgtggac
aaagtggccttcacaggctccaccgaggttggccacctagtccaggttgctgcagggaac
agtaacctcaagagagtgaccctggagctgggaggaaagagccccaatatcatcatgtca
gatgcagacatgaactgggccgtagagcaggcccactttgccctgttcttcaaccagggc
cagtgctgctgtgccggctcccggacctttgtgcaagaagatgtttatgctgagtttgtg
gagcggagtgttgccagggccaagtcacgtgtagttgggaacccctttgacagccagact
gagcaggggccacaggtggatgaaactcagtttaagaagatccttggttatatcaaatct
gggaaggaggagggggcgaaactattgtgtggtggaggggcggctgctgaccgaggctac
tttatccagcccaccgtgtttggagatgtacaagacaccatgactatcgccaaggaggag
atctttgggccagtgatgcagatcctgaagttcaagaccatagaggaagttattgggaga
gccaataattccaagtatgggctggctgcagctgtcttcaccaaggacttggacaaagcc
aattatctgtcccaagccctccaggctggcactgtgtggatcaactgctatgatgtattt
ggggcccagtcaccattcggtggctacaagatgtctgggagtggccgggagctgggagag
tatgggttgcaggcatacacggaagtgaaaactgggcttttcaagcagtacatcctcttg
gaacactttcatctggattgcactcaggctgtaatctctaactcatggctactctag

DBGET integrated database retrieval system