KEGG   Canis familiaris (dog): 611993Help
Entry
611993            CDS       T01007                                 

Gene name
GYS1
Definition
(RefSeq) LOW QUALITY PROTEIN: glycogen [starch] synthase, muscle
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00500  Starch and sucrose metabolism
cfa01100  Metabolic pathways
cfa04151  PI3K-Akt signaling pathway
cfa04152  AMPK signaling pathway
cfa04910  Insulin signaling pathway
cfa04922  Glucagon signaling pathway
cfa04931  Insulin resistance
Module
cfa_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    611993 (GYS1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    611993 (GYS1)
   04152 AMPK signaling pathway
    611993 (GYS1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    611993 (GYS1)
   04922 Glucagon signaling pathway
    611993 (GYS1)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04931 Insulin resistance
    611993 (GYS1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:cfa01003]
    611993 (GYS1)
Enzymes [BR:cfa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     611993 (GYS1)
Glycosyltransferases [BR:cfa01003]
 Polysaccharide
  Storage polysaccharide
   611993 (GYS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_trans_1_4 Glyco_trans_4_4 Glyco_transf_4
Motif
Other DBs
NCBI-GeneID: 611993
NCBI-ProteinID: XP_854809
Ensembl: ENSCAFG00000003858
VGNC: 41574
LinkDB All DBs
Position
1
AA seq 737 aa AA seqDB search
MPLSRTLSMSSLPGLEDWEDEFDLENTVLFEVAWEVANKVGGIYTVLQTKAKVTGDEWGD
NYYLVGPYTEQGVRTQVELLEPPTPALKRTLDSMNSKGCKVYFGRWLIEGGPLVVLLDVG
ASAWALERWKGELWDTCNIGVPWYDREANDAVLFGFLTTWFLGEFLAQNEEKPHVVAHFH
EWLAGIGLCLCRARRLPVATIFTTHATLLGRYLCAGAVDFYNNLENFKGDKEAGERQIYH
RYCMEGAAAHGAQVCTTGXQITPFEAQHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQS
KARIQEFVRGHFYGHLDFNLDKTLYFFIAGRYEFSNKGADVFLEALARLNYLLRVNGSEQ
TVVAFFIMPARTNNFNVETLKGQAVRKQLWDTANTVKEKFGRKLYESLLVGSLPDMNKML
DKEDFTMMKRAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRIGLFNSSADRVKVIFHPE
FLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEE
HIADPSAYGIYILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKY
LGRYYMSARHMALAKAFPEHFTYEPHEADATQGYRYPRPASVPPSPSLSRHSSPHQSEDE
EEPRDGPPDVDGERYDEDEEAAKDRRNIRAPEWPRRASCTSSTGGSKRSSVDTAPSSSLS
TPSEPLSPASSLGEERN
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgcctctaagccgcactttgtccatgtcctcactgccaggactggaggattgggaggat
gaattcgatctggagaacacagtgctcttcgaggtggcctgggaagtggccaacaaggtg
ggtggcatctacaccgtgctgcagacgaaggcgaaggtgacaggggatgagtggggcgac
aactactacctggttggaccgtacacagagcagggcgtgaggacccaggtggaactgctc
gagcccccaaccccagctctgaagaggacactggactccatgaacagcaaaggctgcaag
gtgtatttcggtcgctggctgatcgaggggggccccctggtggtgctcctggatgtgggg
gcctcagcctgggccctggagcgctggaagggggagctctgggacacctgcaacatcggg
gtgccctggtacgaccgtgaggccaacgatgctgtcctttttggcttcctcaccacctgg
ttcctgggtgagttcctggcccagaacgaggagaagccacatgtggttgcacacttccat
gagtggttggcaggcattggactctgcttgtgccgggcccggcggcttcctgtggctaca
atcttcaccacccacgccacgctcctgggacgatacctgtgtgcgggtgccgtagacttc
tacaacaacctggagaatttcaagggggacaaggaagcaggtgagaggcaaatctatcac
cgttactgcatggagggggcagcggcccacggcgctcaggtatgtactacaggtnaacag
atcacgccatttgaggcccagcacctactcaagaggaaaccagatatcgtgacccccaat
gggctgaatgtgaagaagttctccgccatgcatgagttccagaacctccatgctcagagc
aaggctcgaatccaggagtttgtgcggggccatttttatggacacctggacttcaacttg
gacaagaccttgtatttctttatcgctggccgctacgagttctctaacaagggggccgat
gtcttcctagaggccttggcccggctcaattatctgctcagagtgaacggcagcgagcag
acggtggttgccttcttcatcatgccagcccggaccaacaacttcaacgtggaaaccctc
aagggccaagctgtgcgcaagcagctttgggatacagccaacacagtgaaagagaagttc
ggaaggaagctttacgaatccttgctggtggggagcctcccggacatgaacaagatgctg
gacaaggaggacttcactatgatgaagagagccatctttgccacgcagcgacagtctttc
ccccctgtgtgcacccacaacatgctggacgactcctcggaccctatcctgaccaccatc
cgccgaattgggctcttcaatagtagtgctgacagggtcaaggttattttccatccagag
tttctctcctccacgagccccctgctccccgtggattatgaagaatttgtccgtggctgc
caccttggggtctttccctcctactatgaaccttggggctacacgccggctgagtgcacg
gttatgggcatccccagtatctccaccaacctctctggcttcggctgcttcatggaggaa
cacattgcagacccctccgcttacggcatctacatcctggaccggcggttccgcagtctg
gatgattcctgctcccagctcacctccttcctctacagcttctgccagcagagccggcgg
cagcgcatcatccagcgaaaccgcaccgagcgcctctcagaccttctggactggaaatac
ctaggccggtactatatgtctgcacgccacatggcgctggccaaggcctttccagaacac
ttcacctatgagccccacgaggctgacgcgactcagggctaccgctacccgcggccggcc
tcggtgccaccatcgccctcgctgtcgcgccactcaagtccgcaccagagtgaggacgag
gaggagccgcgggacgggccgccggatgtagatggggagcgctacgacgaggacgaggag
gcagccaaggaccggcgcaacatccgcgccccggagtggccgcgccgcgcctcctgcacc
tcttccaccggcgggagcaagcgcagctcggtggacacggcgccctccagctcgctcagc
actcccagtgagcccctcagccctgccagctccctgggcgaggagcgcaactga

DBGET integrated database retrieval system