KEGG   Canis familiaris (dog): 612163Help
Entry
612163            CDS       T01007                                 

Gene name
TMPRSS9
Definition
(RefSeq) transmembrane protease serine 9
  KO
K09640  transmembrane protease serine 9 [EC:3.4.21.-]
Organism
cfa  Canis familiaris (dog)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cfa01002]
    612163 (TMPRSS9)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     612163 (TMPRSS9)
Peptidases [BR:cfa01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   612163 (TMPRSS9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986 Trypsin_2 Ldl_recept_a SEA
Motif
Other DBs
NCBI-GeneID: 612163
NCBI-ProteinID: XP_022263101
Ensembl: ENSCAFG00000019393
VGNC: 47637
LinkDB All DBs
Position
20
AA seq 1183 aa AA seqDB search
MLAAAGGHVESRPRRTPRAPELARARLHGGPRRPRPGQGAPGGGRGAGVTLGPRGLPETG
RPRAAGASGSSAPCLGAMEPIAGDLQLVPGAPKEVPAAGCRVALSALAAASVVMVTLGVL
VASLSTQGVDVEHTAELQGVRYARSLQRETSEYYRVLTPALERLFVSSFQETELEASCVG
CTVLGYRDGNSSVLVHFRLHFLLQALQSLSLGLEEELLQQGLRARLQGHGIPLAAHGTIV
SAELRGSQKGPLTERDLKSGHCPGNTFSCRNSQCVTKVNPECDDRVDCSDGSDEAHCDCG
LQPGWKTAGRIVGGMEASPGEFPWQVSLRENNEHFCGAAVVRARWLVSAAHCFNEFQDPR
EWVAYAGTTYLSGAEASTVRARVARIIPHPSYNPDTADFDVAVLQLDGPLPFGRHVQPVC
LPAATHVFPARRKCLISGWGYLREDFLVKPEALQKATVELLDQGLCAGLYGHSLTDRMMC
AGYLDGKVDSCQGDSGGPLVCEEPSGRFFLAGIVSWGIGCAEARRPGVYARVTRLRDWIL
EAISTASKPLAPTVAPTSTTPSTAWPARPESPVVHSPARPTRGPSMAPPDAVTASKPQEC
GARPAMEKPTRIVGGLGAASGEVPWQASLKEGSRHFCGATVVGDRWLLSAAHCFNHTKVE
LVRAHLGTASLTGVGGSPVKMALRRAVLHPQYNPGILDFDAAILELARPLDFNKFIQPVC
LPLAIQKFPVGRKCMISGWGNTQEGNATKPDILQRASVGIIDQKACSALYNFSLTDRMLC
AGFLEGQVDSCQKSVRLQARLQQHLPGLGTHKLVLKFTQKSEGTSPPGSSSGNLGTHLPA
IPTPAARRAGFRAPASQEARQEPLACPPPTTRLPSRTVADLTVPGDLASRATLQATSRPA
NRTIASTPAGGQTALPSRPGTTTGSQPADCGLAPVAAMTRIVGGSAAGRGEWPWQVSLWL
RRREHRCGAVLVAEKWLLSAAHCFDVYGDPKQWAALLGTPFLGGADGQLERVARIYKHPF
YNLYTLDYDVALLELAGPVRRSRLVRPICLPEPAPRPPDGARCVITGWGSVREGGSMARQ
LQQAAVRVLSEQTCRRFYPVQISSRMLCAGFPQGGVDNSSVSALRPRARAEVGLATAGAV
PPLQVPGPRAPGPPPRSPAGLTSTRRQDARADPASQRAFMETE
NT seq 3552 nt NT seq  +upstreamnt  +downstreamnt
atgctggcggccgcgggtggtcacgtggagtccaggccacgacggacgccgcgggcacca
gagctggcgcgggcccggctccacgggggcccgagacgtccccgtcccgggcagggggca
cctggtggaggccgcggggcgggggtgaccctgggtccccggggcctcccagagacgggc
agaccccgcgctgcgggcgcgtccgggtcgtctgctccgtgtctgggagccatggagccc
atcgctggggacctgcagctcgtgcctggggcaccaaaggaagtcccggctgcgggctgc
cgcgtggccctctctgccctggcggccgccagcgttgtgatggtcaccctgggagtcctc
gtggcttccctctctacacagggggtcgacgtggagcacacggctgagctgcagggggtc
cggtatgcccgcagcctgcagcgagagacctccgagtactaccgcgtgctgacgcccgct
ctggaaaggctgtttgtaagcagctttcaggagacagagttggaggccagctgtgtgggc
tgcactgtgctgggttacagggatgggaattccagtgtcttggttcatttccggctacac
ttcctgctgcaagccctgcagtcactgagtctgggcctggaggaggagctgttgcagcag
ggactccgagcaaggctgcaggggcatggtatccccctggctgcccacggcaccattgtg
tctgctgagctcagaggaagccagaaaggcccattgacggaaagagacttaaaatcaggt
cactgtccagggaacaccttttcctgccggaacagccagtgtgtgaccaaagtgaacccg
gagtgtgatgacagagtggactgctctgatggatctgatgaggcccactgtgactgcggt
ctacagcctggttggaagacggcaggccggatcgtggggggcatggaagcatctcctggg
gagttcccgtggcaagtcagccttcgagaaaacaacgaacacttctgtggggctgctgtc
gtcagggccaggtggctggtgtctgcggcccactgcttcaacgagttccaggacccgaga
gagtgggtggcctatgcgggcacgacctacctcagcggcgcagaagccagcacggtgcgg
gcacgcgtggcccgcatcatcccgcacccgtcgtacaacccggacacggccgacttcgac
gtggcggtgctgcagctggacggccccctccccttcggcaggcacgtccagcccgtgtgc
ctccccgccgccacgcacgtcttcccggcgcggaggaagtgcctgatctcgggctggggc
tacctcagggaggacttcctggtgaagccagaagcgctgcagaaagccaccgtggagctg
ctggaccagggcctgtgcgccggcctgtatggccactcgctcaccgacaggatgatgtgt
gccggctacctggacgggaaggtggactcctgccagggcgactcaggaggccccctggtc
tgcgaggagccctcgggcaggttcttcctggccggcatcgtgagctgggggattggctgt
gccgaagcccggcgtcccggggtctacgcccgagtgaccaggctgcgtgactggatcctg
gaggccatcagcaccgcgagcaagcctctggctcccaccgtggctcccacctccaccacc
cccagcacggcctggcccgcccgtcctgagagcccggtggtccacagccccgccagaccc
acgcggggccccagcatggcgcctcctgacgcagtgaccgcctctaagccccaagagtgc
ggggccaggcctgccatggagaagcccacacggatcgtgggcgggctgggagcagcctcc
ggggaagtgccctggcaggccagcctgaaggaaggttcccggcacttctgtggcgccact
gtggtgggtgaccgctggctgctgtcggctgcccactgcttcaaccacacgaaggtggag
ttggtgcgggcgcacctgggcaccgcgtccctcacgggcgtcggcggaagcccagtgaag
atggcgctcaggagggccgtgctgcacccccagtacaaccccggcattctggacttcgac
gcggccatcctggagctggccaggcccctggacttcaacaagttcatccagcccgtttgc
ctgccgctggccatccagaagttccccgtgggccgcaagtgcatgatctccggctggggg
aacacgcaggagggaaacgctaccaagcctgacattctacagagagcgtcggtgggcatc
atagaccagaaggcctgcagtgccctctacaacttctccctcacggacaggatgctctgt
gccggcttcctagagggccaggtggactcctgccagaagtccgtgcggctccaggcgcga
ctccagcagcatctgccgggactcgggactcacaagctggtgttgaaattcacgcagaag
agcgaaggaacgtccccgccgggcagcagctccgggaacctggggacccacctcccagcc
attccgacccccgcggcccggcgtgctggcttccgggcgccggcgtcccaagaggcccgg
caggagccgctggcgtgtcctccccccaccaccaggcttccttccaggacggtggccgac
ctcacagtcccgggagacctggccagcagagccaccctccaggccaccagccgacctgcc
aacaggaccattgcgagcacgcctgccggtgggcagacagcacttcccagccgcccaggg
accaccacgggctcccagccagcagactgcggcctggcaccggtggcagcgatgaccagg
atcgtgggtggcagcgccgccggccgaggggagtggccgtggcaggtgagcctgtggctg
cggcgccgggagcatcgctgcggggccgtcctggtggccgagaagtggctgctgtcggcg
gcgcactgcttcgacgtctacggggaccccaagcagtgggcggccctcctgggcaccccg
ttcctgggcggcgccgacgggcagctggagcgcgtggcgcgcatctacaagcaccccttc
tacaacctctacacgctcgactacgacgtggcgctgctcgagctggcggggcccgtgcgc
cgcagccgcctggtgcggcccatctgcctgcccgagcccgcgccgcggccgcccgacggc
gcgcgctgcgtcatcaccggctggggctcggtgcgcgagggaggctccatggcgcggcag
ctgcagcaggcggccgtgcgcgtcctcagcgagcagacgtgccgccgcttctacccggtg
cagatcagcagccgcatgctgtgcgccggcttcccgcagggcggcgtggacaacagctcg
gtgagcgcactccgcccgcgcgcccgcgccgaggtgggcctggccacagcaggggccgtg
ccgccgctccaagtcccgggcccccgggcccccgggcccccgccgcgctcgccggccggt
ctcacaagcacgcgcaggcaggacgcacgggcggaccccgcctcgcaaagggcttttatg
gaaacagagtga

DBGET integrated database retrieval system