KEGG   Canis familiaris (dog): 612418Help
Entry
612418            CDS       T01007                                 

Gene name
TCL1B
Definition
(RefSeq) T-cell leukemia/lymphoma protein 1B
  KO
K16836  T-cell leukemia/lymphoma 1B
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04151  PI3K-Akt signaling pathway
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    612418 (TCL1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TCL1_MTCP1
Motif
Other DBs
NCBI-GeneID: 612418
NCBI-ProteinID: XP_855242
LinkDB All DBs
Position
8
AA seq 128 aa AA seqDB search
MASGPFPCLGLPPHRLWALRPGIYEDERGRTWVIVVVRLSPSWRAQGRAPRHHAHEPSIT
VHIWQMPVHPQVPMLPSELTLSQLPFTWQLHPGGRYRAMDSRLWEIEDHGQVDSTEQLIL
TQLPPGND
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atggcctccgggccttttccatgccttgggttgcccccacaccgtctgtgggctctgagg
cctggcatctatgaggacgagagggggcggacctgggtgatcgtggtggtgcggctcagt
ccctcctggagagctcagggcagggccccccgccaccatgcgcatgaacccagcatcaca
gtccacatatggcagatgccagtgcacccccaggtgcccatgctccccagcgagctgacc
ctctcccagctgcccttcacatggcagctccaccctggaggaaggtacagagcaatggat
tccagactctgggaaatagaggaccacggccaggttgactccacagagcagctgatcctg
acacagctgccaccggggaatgactga

DBGET integrated database retrieval system