KEGG   Canis lupus familiaris (dog): 612576
Entry
612576            CDS       T01007                                 

Gene name
IKBKG
Definition
(RefSeq) NF-kappa-B essential modulator isoform X6
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa01523  Antifolate resistance
cfa04010  MAPK signaling pathway
cfa04014  Ras signaling pathway
cfa04062  Chemokine signaling pathway
cfa04064  NF-kappa B signaling pathway
cfa04151  PI3K-Akt signaling pathway
cfa04210  Apoptosis
cfa04380  Osteoclast differentiation
cfa04620  Toll-like receptor signaling pathway
cfa04621  NOD-like receptor signaling pathway
cfa04622  RIG-I-like receptor signaling pathway
cfa04623  Cytosolic DNA-sensing pathway
cfa04625  C-type lectin receptor signaling pathway
cfa04657  IL-17 signaling pathway
cfa04658  Th1 and Th2 cell differentiation
cfa04659  Th17 cell differentiation
cfa04660  T cell receptor signaling pathway
cfa04662  B cell receptor signaling pathway
cfa04668  TNF signaling pathway
cfa04920  Adipocytokine signaling pathway
cfa05132  Salmonella infection
cfa05135  Yersinia infection
cfa05142  Chagas disease
cfa05145  Toxoplasmosis
cfa05160  Hepatitis C
cfa05161  Hepatitis B
cfa05162  Measles
cfa05163  Human cytomegalovirus infection
cfa05164  Influenza A
cfa05165  Human papillomavirus infection
cfa05166  Human T-cell leukemia virus 1 infection
cfa05167  Kaposi sarcoma-associated herpesvirus infection
cfa05168  Herpes simplex virus 1 infection
cfa05169  Epstein-Barr virus infection
cfa05170  Human immunodeficiency virus 1 infection
cfa05200  Pathways in cancer
cfa05203  Viral carcinogenesis
cfa05212  Pancreatic cancer
cfa05215  Prostate cancer
cfa05220  Chronic myeloid leukemia
cfa05221  Acute myeloid leukemia
cfa05222  Small cell lung cancer
cfa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cfa05340  Primary immunodeficiency
cfa05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    612576 (IKBKG)
   04014 Ras signaling pathway
    612576 (IKBKG)
   04064 NF-kappa B signaling pathway
    612576 (IKBKG)
   04668 TNF signaling pathway
    612576 (IKBKG)
   04151 PI3K-Akt signaling pathway
    612576 (IKBKG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    612576 (IKBKG)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    612576 (IKBKG)
   04621 NOD-like receptor signaling pathway
    612576 (IKBKG)
   04622 RIG-I-like receptor signaling pathway
    612576 (IKBKG)
   04623 Cytosolic DNA-sensing pathway
    612576 (IKBKG)
   04625 C-type lectin receptor signaling pathway
    612576 (IKBKG)
   04660 T cell receptor signaling pathway
    612576 (IKBKG)
   04658 Th1 and Th2 cell differentiation
    612576 (IKBKG)
   04659 Th17 cell differentiation
    612576 (IKBKG)
   04657 IL-17 signaling pathway
    612576 (IKBKG)
   04662 B cell receptor signaling pathway
    612576 (IKBKG)
   04062 Chemokine signaling pathway
    612576 (IKBKG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    612576 (IKBKG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    612576 (IKBKG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    612576 (IKBKG)
   05203 Viral carcinogenesis
    612576 (IKBKG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    612576 (IKBKG)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    612576 (IKBKG)
   05221 Acute myeloid leukemia
    612576 (IKBKG)
   05220 Chronic myeloid leukemia
    612576 (IKBKG)
   05215 Prostate cancer
    612576 (IKBKG)
   05222 Small cell lung cancer
    612576 (IKBKG)
  09163 Immune disease
   05340 Primary immunodeficiency
    612576 (IKBKG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    612576 (IKBKG)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    612576 (IKBKG)
   05135 Yersinia infection
    612576 (IKBKG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    612576 (IKBKG)
   05170 Human immunodeficiency virus 1 infection
    612576 (IKBKG)
   05162 Measles
    612576 (IKBKG)
   05164 Influenza A
    612576 (IKBKG)
   05161 Hepatitis B
    612576 (IKBKG)
   05160 Hepatitis C
    612576 (IKBKG)
   05168 Herpes simplex virus 1 infection
    612576 (IKBKG)
   05163 Human cytomegalovirus infection
    612576 (IKBKG)
   05167 Kaposi sarcoma-associated herpesvirus infection
    612576 (IKBKG)
   05169 Epstein-Barr virus infection
    612576 (IKBKG)
   05165 Human papillomavirus infection
    612576 (IKBKG)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    612576 (IKBKG)
   05142 Chagas disease
    612576 (IKBKG)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    612576 (IKBKG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cfa01001]
    612576 (IKBKG)
Protein kinases [BR:cfa01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   612576 (IKBKG)
SSDB
Motif
Pfam: CC2-LZ NEMO zf_C2H2_10 Filament LLC1 zf_C2H2_ZHX
Other DBs
NCBI-GeneID: 612576
NCBI-ProteinID: XP_003640286
Ensembl: ENSCAFG00000019605
VGNC: 41922
UniProt: F1Q438
LinkDB
Position
X
AA seq 419 aa
MSRAPWKSQPSEMVQPSGGPAGDQDVLGEESSLGKPAMLHLPSEQGTPETYQRCLEENQE
LRDAIRQSNQMLRERCEELQRFQGSQRKEKEFLMQKFQEARKLVERLSLEKLDLRTQREQ
ALQEVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKERQALEGRARAASEQ
ARQLESEREALQQQHSVQVDQLRMQSQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQE
YDNHIKSSMVSSERNRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPV
LKAQADIYKADFQAERQAREKLAEKKEILQDQLEQLQREYSRLKASCQESARIEDLRKRH
VEVSQAPLPVTPVHASFHVPVSIQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE
NT seq 1260 nt   +upstreamnt  +downstreamnt
atgagcagggccccctggaagagtcagccaagtgagatggtgcagcccagtggcggcccg
gccggggaccaggacgtgctgggtgaagagtcttctttggggaagccagctatgctccac
ctaccttccgagcagggcactcctgagacctaccaacgctgtctggaggagaatcaagag
ctccgggatgccatccggcagagcaaccagatgctccgggagcgctgtgaggagctgcag
cgtttccagggcagccagaggaaggagaaggagttcctcatgcagaagttccaggaagcc
aggaaactggtggagagactgagtctggagaagctcgacctgaggacgcagagggagcag
gccctgcaggaggtggaacacctgaagcgatgtcagcagcagatggctgaagacaaggct
tccgtgaaagcccaggtgacgtccctgctgggggagctccaggagagccagagtcgtttg
gaggccgccaccaaggagcggcaggctttggagggcagggcccgggctgccagcgagcag
gcccggcagctggagagcgagcgggaggcgctgcagcagcagcacagcgtgcaggtggac
cagctgcgcatgcagagccagagcgtggaggcggccctgcgcatggagcgccaggctgcc
tcggaggagaagcggaagctggcccagctacaggtggcctatcaccagctcttccaggag
tatgacaaccacatcaagagcagcatggtgagcagcgagcgaaaccgaggaatgcagctg
gaggatctcaagcagcagctccagcaggccgaggaggccctggtggccaaacaggaagtg
atcgacaagctgaaggaagaggccgagcagcacaagatcgtgatggagaccgtcccggtg
ctaaaggctcaggcggatatatacaaggccgacttccaggccgagaggcaggcccgggag
aagctggctgagaagaaggagatcctgcaggatcagctggagcagctgcagagggagtac
agcaggctgaaggccagctgtcaggagtcggccaggattgaagatctgaggaagcggcac
gtggaggtctcccaggctcccttacccgtcaccccagttcacgcctcctttcacgtgccc
gtgtccatccagaggagaagcccccccgaggagccaccggacttctgctgccccaagtgc
cagtatcaggcccctgatatggacaccctgcagatacacgtcatggagtgcatcgagtag

DBGET integrated database retrieval system