KEGG   Citrobacter farmeri: CI104_01115Help
Entry
CI104_01115       CDS       T05012                                 

Gene name
yhjD
Definition
(GenBank) inner membrane protein YhjD
  KO
K07058  membrane protein
Organism
cfar  Citrobacter farmeri
Brite
KEGG Orthology (KO) [BR:cfar00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    CI104_01115 (yhjD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB DUF5510 SSPI DUF4381
Motif
Other DBs
NCBI-ProteinID: AST77778
UniProt: A0A223JKM2
LinkDB All DBs
Position
complement(229590..230618)
Genome map
AA seq 342 aa AA seqDB search
MMQDNNVKRPTEELEHDPVRKVDTTATAEHEKKSTASETLKTVTTTVEKIQRIPVIAHLL
RAAERFNDRLGNQFGAAITYFSFLSMIPILMVSFAAAGFILASHPTLLQDIFNKILMNVS
DPTLAATLKSTINTAVQQRTTVGLVGLGIALYSGINWMGNLREAIRAQSRDVWERTPQDQ
EKIWIKYLRDFISLIGLLIALIVTLSITSVAGSAQQMIISALYLDSIEWLKPTWRLIGLA
ISIFANYLLFFWIFWRLPRHRPRKKALIRGTLIAAIGFEVIKIIMTWTLPALVKSPSGAA
FGSVLGLMAFFYFFARLTLFCAAWIATAEYKDDPRMPGKTHR
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgatgcaggataacaacgtaaaacgccccactgaggaacttgaacacgatccggtgcgc
aaagtcgacacaaccgcaaccgcagaacacgagaagaaaagcaccgccagcgagacgctg
aaaacggtcaccaccaccgtcgaaaaaatccagcgcatcccggtgattgcgcacctgctc
cgtgcggctgaacgctttaacgatcggttagggaatcagttcggcgcggccattacctac
ttctcgtttttgtctatgatccctatcctgatggtgtcatttgccgccgcaggctttatt
ctcgcctcacatcccacgctattgcaggacatcttcaataaaatcctgatgaacgtcagc
gacccgacgcttgccgcgacgctgaaaagtaccatcaatactgctgtacagcagcgtact
accgtcggtctggtcgggttagggatcgccctctactccgggattaactggatgggtaat
ctgcgcgaggcgatacgcgcccagtcgcgggacgtctgggaacgcacgccgcaggatcag
gagaaaatctggatcaaatacctgcgtgattttatctcactgattggcctgttgattgcg
ctgattgtgacgctgtcgatcacctcggtcgccggttcggcgcaacagatgattatctcc
gccctctacctcgacagcatagagtggctgaaacccacctggcggttgattggtctggcg
atctctattttcgccaactatctgctgttcttctggattttctggcgcttgcctcgtcat
cgcccgcgtaaaaaagcgttgattcgcggtacgctgattgcggcgattggctttgaggtc
attaaaatcatcatgacctggaccctgccggcactggtgaaatcgccctccggcgcggcg
tttggttccgtgctggggctgatggcgttcttctactttttcgcgcgcctgacgctgttc
tgcgcggcctggattgcgactgccgagtacaaggatgacccccggatgccgggcaaaacg
caccgttga

DBGET integrated database retrieval system