KEGG   Citrobacter farmeri: CI104_06045Help
Entry
CI104_06045       CDS       T05012                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
cfar  Citrobacter farmeri
Pathway
cfar00473  D-Alanine metabolism
cfar00550  Peptidoglycan biosynthesis
cfar01100  Metabolic pathways
cfar01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cfar00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CI104_06045
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CI104_06045
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    CI104_06045
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cfar01011]
    CI104_06045
Enzymes [BR:cfar01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CI104_06045
Peptidoglycan biosynthesis and degradation proteins [BR:cfar01011]
 Precursor biosynthesis
  Amino acid ligase
   CI104_06045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATPgrasp_ST ATP-grasp_3 ATP-grasp_4 RimK PTS_2-RNA NHase_alpha
Motif
Other DBs
NCBI-ProteinID: AST78672
UniProt: A0A223JNB4
LinkDB All DBs
Position
complement(1229048..1230142)
Genome map
AA seq 364 aa AA seqDB search
MAKLRVGIVFGGKSAEHEVSLQSAKNIVDAIDKTRFEVVLLGIDKQGQWHVSDANNYLLN
ANDPAHIALRPSATSLAQVPGRHAQQLIDAQNGQPLPTVDVIFPIVHGTLGEDGSLQGML
RVANLPFVGSDVLGSAACMDKDVTKRLLRDAGLHIAPFITLTRANRNTINFAEVEARLGL
PLFVKPANQGSSVGVSKVTSEAQYDQAVALAFEFDHKVVVEQGIKGREIECAVLGNDHPQ
ASTCGEIVLNSDFYAYDTKYIDDNGAKVVVPAAIEPQINDKIRDIAIQAYQTLGCAGMAR
VDVFLTADNEVVINEINTLPGFTNISMYPKLWQASGLGYTDLITRLIELALERHAADNAL
KTTM
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagttgcgggtaggtatcgtatttggtggtaaatcagcggaacatgaagtgtca
ttgcaatcggcaaaaaatattgtcgatgccatcgacaagacgcgctttgaagttgtgttg
ttaggcattgataagcaagggcagtggcacgtcagcgatgccaacaattacctgctcaat
gcaaacgatccggcgcatattgcgctgcgtccttctgcaaccagcctggcccaggttccg
ggcagacatgcacagcagttgattgatgcgcagaatggtcagccgctgccgaccgtggac
gtgattttcccgattgtacacggcacgctgggtgaagatggttcactacagggaatgctg
cgcgtggcgaatctgcccttcgtcggttccgacgtgctgggctcagcggcatgcatggat
aaagacgtcaccaaacgtttgttgcgtgatgccggactgcatatcgcaccgtttatcacg
ctgacgcgagccaaccgcaacacgataaactttgccgaggtagaagcccgtcttggtctg
ccgctgttcgttaagcccgcgaatcagggatcgtcggttggcgtcagtaaagtcaccagc
gaagcgcagtacgatcaggctgtcgccctggcgttcgaattcgatcacaaagtggttgtc
gagcaaggaatcaaggggcgtgagatcgagtgcgcagtgttgggcaacgatcatccgcag
gccagcacctgcggcgagatcgttctcaatagtgatttctatgcctacgacaccaaatac
attgatgataacggcgcgaaagtggtagtccctgcggcgattgagcctcagatcaacgac
aaaatccgcgacattgccattcaggcgtatcagacgctgggctgcgccggcatggcgcgc
gtcgatgtcttcttaaccgccgacaatgaggtagtgatcaatgagatcaacaccctgcca
ggcttcaccaacatcagcatgtatccgaaactgtggcaggccagcggtttagggtacacc
gatttgatcacccgtttgatcgagctggcgctggagcgacacgctgcggataatgcgctg
aaaaccacgatgtaa

DBGET integrated database retrieval system