KEGG   Citrobacter farmeri: CI104_06065Help
Entry
CI104_06065       CDS       T05012                                 

Definition
(GenBank) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
cfar  Citrobacter farmeri
Pathway
cfar00730  Thiamine metabolism
cfar00790  Folate biosynthesis
cfar01100  Metabolic pathways
cfar02020  Two-component system
Module
cfar_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:cfar00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    CI104_06065
   00790 Folate biosynthesis
    CI104_06065
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CI104_06065
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cfar04147]
    CI104_06065
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cfar00537]
    CI104_06065
Enzymes [BR:cfar01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     CI104_06065
Exosome [BR:cfar04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CI104_06065
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cfar00537]
 Enzymes
  CI104_06065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Sulfatase Phosphodiest
Motif
Other DBs
NCBI-ProteinID: AST78675
UniProt: A0A223JN47
LinkDB All DBs
Position
1232914..1234329
Genome map
AA seq 471 aa AA seqDB search
MKRSAIALALLPLLYIPVSHSETSSMSVLDNRAAQGDITTPGGARRLSADQTQALRESLN
DKPAKNIILLIGDGMGDSEITAARNYAEGAGGYFKGIDALPLTGQYTHYALNKKTGKPDY
VTDSAASATAWTTGVKTYNGALGVDIHEKDHTTLLEMAKAAGLATGNVSTAELQDATPAA
LVAHVTSRKCYGPSVTSEKCPTNALEKGGKGSITEQLLNARADVTLGGGAKTFTETATAG
EWQGKTLREQAEARGYQLVGDAASLAAIGEANQDKPLLGLFSDGNMPVRWEGPKASYHGN
IDKPAVTCTPNPKRDESVPTLAQMTDKAIELLSKNEKGFFLQVEGASIDKQDHAANPCGQ
IGETVDLDEAVQRALAFAKKDGNTLVIVTADHAHASQIVAPETKAPGLTQALNTKDGAVM
VISYGNSEEESQEHTGSQLRIAAYGPHAANVVGLTDQTDLFYTMKAALGLK
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacgaagcgctatcgctcttgcattgttaccgctgttgtatatccccgtcagccat
tctgaaacatcatcaatgtcggttctggacaaccgcgccgcgcagggtgatattacaaca
cctggcggagcacgccgattatcggccgatcaaacacaagcattgcgcgaatcactgaat
gataaaccagcaaaaaatattattttattgattggcgatggtatgggtgattcagaaatt
accgctgcgcgaaattatgctgaaggtgcaggtggttattttaaagggattgatgcctta
ccgctcaccggccaatacacccactatgcactgaataaaaaaaccggtaagccggattac
gtgacagattctgctgcatcggcgaccgcatggacaactggcgtgaaaacctataatggc
gcgctgggtgtcgatattcacgaaaaagatcacacgacgctgttggaaatggcgaaagcg
gcaggcctggcgacgggtaacgtctcgaccgcagagctgcaggatgccacgcctgccgcg
ctggtggcgcacgtcacgtcgcggaaatgttatggtccgagcgtgacgagcgaaaaatgt
ccgacgaatgcgctggaaaaaggcggaaaaggttcgattaccgagcaacttctgaatgcc
cgtgcagatgtgacgttgggcggcggcgcgaaaacgttcaccgaaaccgcgacggcgggc
gagtggcaaggaaaaacgctgcgtgaacaggcggaggcccggggctaccaactggtcggc
gacgcggcctcgctggcggcaattggtgaagcgaatcaggacaaaccgctgctgggactt
ttctctgatggcaacatgcccgtgcgctgggaaggccccaaagcgtcttatcatggcaat
attgataagcccgccgtgacctgtacgccgaaccctaaacgagacgagagtgtgccaacg
ctggcgcaaatgaccgacaaagccattgagttgctcagcaaaaatgagaaaggattcttc
ttgcaggtggaaggcgcctctatcgataaacaggatcacgccgccaacccctgcggacag
attggcgagacggtggatctggatgaagccgtacagcgcgcgctggcctttgcgaagaaa
gacgggaacacgctggtgattgtcaccgccgatcacgcccacgccagccagatcgtcgcg
ccggagacaaaagcaccgggcctgactcaggcgctaaataccaaagatggtgccgtgatg
gtgatcagctacggcaactccgaagaggagtctcaggagcatacgggcagccagttacgc
attgcggcctacggtcctcatgcggccaatgtggtcggactgaccgatcaaaccgatctg
ttctataccatgaaggccgcgttgggcctgaaataa

DBGET integrated database retrieval system