KEGG   Citrobacter farmeri: CI104_06635Help
Entry
CI104_06635       CDS       T05012                                 

Definition
(GenBank) molecular chaperone HtpG
  KO
K04079  molecular chaperone HtpG
Organism
cfar  Citrobacter farmeri
Brite
KEGG Orthology (KO) [BR:cfar00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cfar01009]
    CI104_06635
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:cfar03110]
    CI104_06635
   04131 Membrane trafficking [BR:cfar04131]
    CI104_06635
   03051 Proteasome [BR:cfar03051]
    CI104_06635
   03029 Mitochondrial biogenesis [BR:cfar03029]
    CI104_06635
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cfar04147]
    CI104_06635
Protein phosphatases and associated proteins [BR:cfar01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     CI104_06635
Chaperones and folding catalysts [BR:cfar03110]
 Heat shock proteins
  HSP90
   CI104_06635
Membrane trafficking [BR:cfar04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    CI104_06635
Proteasome [BR:cfar03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    CI104_06635
Mitochondrial biogenesis [BR:cfar03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    CI104_06635
Exosome [BR:cfar04147]
 Exosomal proteins
  Proteins found in most exosomes
   CI104_06635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP90 HATPase_c HATPase_c_3 HP0268 PE Apolipoprotein
Motif
Other DBs
NCBI-ProteinID: AST78782
UniProt: A0A223JNM0
LinkDB All DBs
Position
1348295..1350169
Genome map
AA seq 624 aa AA seqDB search
MKGQETRGFQSEVKQLLHLMIHSLYSNKEIFLRELISNASDAADKLRFRALSNPDLYEGD
GELRVRVSFDKDKRTLTIADNGVGMNRDDVIDHLGTIAKSGTKSFLESMGSDQAKDSQLI
GQFGVGFYSAFIVADKVTVRTRAAGDKPENGVFWESAGEGEYTVGDITKDDRGTEITLHL
REGEDEFLDDWRVRSIISKYSDHIALPVEIEKQEEKDGETVVSWEKINKAQALWTRNKSE
IKDDEYNEFYKHIAHDFTDPLTWSHNRVEGKQEYTSLLYIPSQAPWDMWNRDHKHGLKLY
VQRVFIMDDAEQFMPNYLRFVRGLIDSNDLPLNVSREILQDSSVTRNLRSALTKRVLQML
EKLAKDDAEKYQTFWQQFGLVMKEGPAEDHANQETIAKLMRFASTHTDSSAQTVSLEDYV
SRMKEGQEKIYYITADSYAAAKSSPHLELLRKKGIEVLLLSDRIDEWMMNYLTEFDGKAF
QSVAKADESIDKLADEVDESAKEAEKALTPFVERVKTLLGDRVKDVRLTHRLTDTPAIVT
TDADEMSTQMAKLFAAAGQNVPEVKYIFELNPDHVLVKRTAETQDDAKFNEWVELLLDQA
LFAERGTLEDPNQFIRRMNQLLVS
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggacaagaaactcgtgggtttcagtcagaggtaaaacaacttctgcatctgatg
atccattctctgtattccaataaagaaatcttcctgcgtgagcttatctctaacgcctcc
gatgcggcagacaagctgcgttttcgcgcgctgtcgaacccggacctctatgaaggcgac
ggtgaactgcgcgtgcgcgtctccttcgataaagataagcgtacgttgaccattgccgat
aacggcgtggggatgaaccgtgatgatgtgattgatcatctggggaccattgcgaagtcc
gggaccaaatctttcctcgaatctatgggctccgatcaggcgaaagacagccaattgatc
ggccagtttggggttggcttctattccgcgtttatcgtggcggataaagtgacggtccgc
acgcgcgccgcgggcgacaagccggagaatggcgtgttctgggagtcggctggcgaaggt
gaatacaccgttggtgatatcaccaaagacgatcgcggaacggaaatcacgctgcatctg
cgtgaaggggaagacgagttcctcgatgactggcgcgtacgttccatcatcagcaaatat
tccgaccatatcgcactgccggttgagattgaaaaacaggaagagaaagatggcgaaacc
gtcgtttcctgggagaaaatcaacaaggctcaggcgctgtggacccgtaacaagtcggaa
atcaaagacgacgagtacaacgagttttacaagcatatcgcgcatgattttaccgatccg
ctgacctggagccacaaccgtgtggaagggaagcaggagtacaccagcctgctgtatatc
ccgtctcaggcgccgtgggacatgtggaaccgcgatcacaagcacggtctgaaactgtat
gttcagcgcgtctttatcatggacgacgccgagcagttcatgccgaactacctgcgcttc
gtgcgagggcttatcgactctaacgatctgccgctgaacgtctctcgtgagatcctgcag
gacagcagcgttactcgcaatctgcgtagcgcgttgaccaaacgtgttctgcaaatgctg
gaaaaactggcgaaagacgacgcggaaaaataccagacgttctggcagcagttcggtctg
gtgatgaaagaaggtccggcggaagatcacgctaaccaggaaaccatcgccaaactgatg
cgtttcgcgtcaacgcataccgactcttctgcgcagacggtctctctggaagactacgtc
tcccgcatgaaagaagggcaggagaaaatctactacatcaccgcagacagctatgcagcg
gcgaaaagcagcccgcatctggaactgctgcgtaagaaaggcatcgaagtactgctgctt
tccgatcgcattgacgagtggatgatgaactacctgaccgagttcgatggtaaggcgttc
cagtccgtcgccaaagcggacgagtcgatcgacaagctggccgatgaggttgatgaaagc
gcgaaagaagcggaaaaagcgctgacgccgttcgtggagcgtgtgaaaaccctgctgggc
gaccgggtaaaagacgtgcgtctgacgcatcgtctgaccgatacgccggcgattgtcact
accgacgcggacgaaatgagcacccagatggcgaaactgtttgccgctgcgggtcagaac
gtgccggaagtgaaatacatctttgaacttaacccggaccacgtgctggtgaaacgcaca
gctgagacccaggacgacgcgaagttcaacgagtgggttgaactgctgctggatcaggcg
ctgtttgctgagcgcggcacgctcgaagatccaaaccagttcatccgccgtatgaaccaa
ctgctggtttcctga

DBGET integrated database retrieval system