KEGG   Citrobacter farmeri: CI104_07385Help
Entry
CI104_07385       CDS       T05012                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
cfar  Citrobacter farmeri
Brite
KEGG Orthology (KO) [BR:cfar00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CI104_07385
Enzymes [BR:cfar01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     CI104_07385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored NAD_binding_8 FAD_binding_3 Thi4 K_oxygenase Glutaredoxin AlaDh_PNT_C DAO FMO-like
Motif
Other DBs
NCBI-ProteinID: AST78922
UniProt: A0A223JP14
LinkDB All DBs
Position
1511388..1512953
Genome map
AA seq 521 aa AA seqDB search
MLDTNMKTQLKAYLEKLTKPVELIATLDDSAKSAEIKELLAEIAELSEKVTFKEDNSLAV
RKPSFLITNPGSNQGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQSLLEQIRDIDGDFE
FETYYSLSCHNCPDVVQALNLMAVLNPRIKHTAIDGGTFQNEITERNVMGVPAVYVNGKE
FGQGRMTLTEIVAKVDTGAEKRAAEELSQRDAYDVLIVGSGPAGAAAAVYSARKGIRTGL
MGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVDDYDVDVIDSQSASKLLPATSEG
GLHQIETASGAILKARSIIIATGAKWRNMNVPGEDQYRTKGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDKVRSLKNVDIILNAQTTEVKGD
GTKVVGLEYRDRVSGDVHNIELAGIFVQIGLLPNTTWLEGAIERNRMGEIIIDAKCETSV
KGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTKTA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacacaaatatgaaaacccagctcaaggcctatcttgagaaactgacgaaaccc
gttgagctgattgcgacgctggatgacagcgctaaatcggcagaaatcaaggaattgctg
gctgagatcgccgaactgtcagagaaagtcacctttaaagaagacaacagcttagccgta
cgcaaaccctctttcctgatcactaatccgggttcaaatcagggaccgcgttttgcaggc
tccccgttgggacacgagtttacctcgctggttctggcgctactgtggaccggtggacac
ccgtcaaaagaagcacagtctctgcttgagcaaatccgcgatattgatggtgattttgag
tttgaaacctattactcactctcctgccataactgccctgacgtggtgcaggcgctgaac
ctgatggcggtgctgaacccacgtattaagcatacggcgattgatggcggcacgttccag
aacgagatcaccgagcgtaacgtgatgggcgttccggccgtgtacgttaatggtaaagag
tttggtcagggtcgcatgacgctgacggaaatcgtggcgaaagtggataccggcgcagaa
aaacgcgcggcagaagaactgagccagcgtgatgcctatgatgttctgattgtcggctcc
ggcccggcgggcgcggcagcagcggtttactccgcgcgtaaaggcattcgtaccggtctg
atgggcgagcgcttcggcggtcaggtactcgatactgtggatatcgaaaactacatttct
gtaccgaaaacagaagggcagaaactggccggcgcgctcaaggcccacgtcgatgattat
gacgtcgacgtgatcgacagccagagcgccagtaagctgctgcctgcgaccagtgaaggc
ggtttacatcagattgaaacggcgtctggcgcgatactgaaagcgcgcagcattatcatt
gccaccggtgcgaaatggcgcaatatgaacgttcccggtgaagatcagtatcgtaccaaa
ggcgttacctattgcccgcactgcgacggcccgctgtttaaaggtaagcgcgtggcagtg
atcggcggcggtaactccggcgtggaagcggcgattgatctcgccggtatcgttgaacac
gtgacgctgctggaatttgccccggaaatgaaggcggatcaggtactgcaggataaagtt
cgcagtctgaaaaacgtcgatatcatcctgaacgcccagacgacggaagtgaaaggcgat
ggcacgaaagtggtcggtctggaataccgtgaccgcgtgagtggcgatgttcacaacatt
gaactggcgggcattttcgttcagattggccttctgccaaacaccacctggctggaaggg
gcgattgagcgcaaccggatgggtgaaatcatcatcgacgcgaaatgcgaaaccagcgtg
aagggcgtatttgccgcgggcgactgtaccaccgtaccgtacaaacagattatcatcgcg
accggcgaaggggcgaaagcgtctctgagtgcctttgattacctgattcgtacgaaaacg
gcataa

DBGET integrated database retrieval system