KEGG   Citrobacter farmeri: CI104_14300Help
Entry
CI104_14300       CDS       T05012                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
cfar  Citrobacter farmeri
Pathway
cfar00240  Pyrimidine metabolism
cfar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfar00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    CI104_14300
Enzymes [BR:cfar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     CI104_14300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK KdpD AAA_22 AAA_30
Motif
Other DBs
NCBI-ProteinID: AST80161
UniProt: A0A223JSF2
LinkDB All DBs
Position
complement(2883343..2883960)
Genome map
AA seq 205 aa AA seqDB search
MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTVVYTAEIDDRYGAGKVSSRIGLSSPAK
LFNQNSSLYEEIAADNALQPIHCVLVDECQFLTRQQVYELSEVVDQLDIPVLCYGLRTDF
RGELFVGSQYLLAWSDKLVELKTICFCGRKASMVLRLDQAGRPYNEGEQVVIGGNERYVS
VCRKHYKEALEEGSLTAIQERHSHD
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggcacagctatatttctactattcagcaatgaatgcaggtaagtcgactgccttactg
caatcttcatacaattaccaggaacgcggcatgcgtactgtcgtatataccgccgaaata
gacgatcgttatggtgcggggaaagtgagttcgcgtatcgggttgtcttcccccgccaaa
ttatttaaccagaattcatcgttgtatgaagagattgctgccgataatgcactacagcct
attcattgtgtgctggtggacgaatgtcagtttttaacccgacagcaggtttatgaatta
tcggaagttgttgatcaactggatattccggtgctgtgctacggattgcgtactgatttt
cgcggcgaactgtttgttggtagccaatacctgctggcgtggtcagataagctggtagaa
ttaaaaacgatctgcttctgcggacgtaaagcgagtatggtgctacgacttgatcaggca
ggcagaccctataatgagggcgagcaggtggtcattggcggcaacgagcggtatgtgtct
gtctgtcgtaagcattataaggaagcgctcgaggagggctccctgacggcgatacaggaa
cgtcatagccacgattag

DBGET integrated database retrieval system