KEGG   Citrobacter farmeri: CI104_15820Help
Entry
CI104_15820       CDS       T05012                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
cfar  Citrobacter farmeri
Pathway
cfar00500  Starch and sucrose metabolism
cfar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CI104_15820
Enzymes [BR:cfar01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     CI104_15820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 Alpha-amylase_C DUF1939 Malt_amylase_C
Motif
Other DBs
NCBI-ProteinID: AST80437
UniProt: A0A223JT83
LinkDB All DBs
Position
3162048..3163535
Genome map
AA seq 495 aa AA seqDB search
MKNPTLLQFFHWYYPDGGKLWQEVTERADSLNDIGINMVWLPPAYKGASGGYSVGYDSYD
LFDLGEFDQKGTIATKYGDKAQLLAAVDALKKNDIAVLLDVVVNHKMGADEKEPIRVQRV
NEEDRTQIADEIIDCEGWTRYTFPARGGQYSQFIWDFKCFSGIDHIENPDEDGIFKIVND
YTGEGWNDQVDDELGNFDYLMGENIDFRNHAVTEEIKYWARWVMEQTQCDGFRLDAVKHI
PAWFYKEWIEHVQEVAPKPLFIVAEYWSHEVDKLQTYIDQVEGKTMLFDAPLQLNFHEAS
RQGRDYDMSQIFSGTLVEADPFHAVTLVANHDTQPLQALEAPVEAWFKPLAYALILLREN
GVPSVFYPDLYGAHYEDTGGDGETYTIDMPIIEQLDELILARQRFAHGIQTLWFDHPNCI
AFSRSGTDDDPGCVVVLSNGDDGEKTLALGANYGNKTWRDFLGNRSESVVTDENGDATFY
CNAGSVSVWVIEEVI
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatcccacgttactgcagttcttccactggtattaccccgacggcggcaaactc
tggcaggaagtgacagagcgcgccgacagcctcaacgatatcggtatcaatatggtctgg
ctgccgcccgcctataaaggcgcatcaggcggctattccgtcggctatgactcttacgat
ctgttcgatctcggcgagttcgatcaaaaaggcaccattgccaccaaatatggtgataag
gcgcagctgctggcggctgtcgatgcgctgaaaaaaaacgacatcgcggtgctgctcgat
gtggtggtgaatcacaaaatgggagcagacgagaaagaacccatccgcgtacagcgcgtc
aacgaagaggatcgcacgcagattgcggatgagatcatcgactgtgaaggctggacgcgt
tacacctttccagcgcgaggcggccagtactctcagttcatctgggatttcaaatgtttc
agcggtatcgaccacatcgaaaatcctgacgaagacggcatctttaagatcgtcaatgac
tacactggcgagggctggaacgatcaggtcgatgacgaactgggtaatttcgattacctg
atgggcgaaaatatcgactttcgtaatcacgccgtcaccgaggagattaaatactgggcg
cgctgggtgatggaacaaacccagtgtgacggctttcgcctcgatgcggtcaagcacatt
ccagcctggttctataaagagtggattgaacatgtccaggaggtggcaccgaaaccgttg
tttatcgtcgccgaatactggtcgcatgaagtagataagctacaaacctatatcgaccag
gtggaaggcaaaacgatgctgttcgatgccccattacagctcaattttcatgaagcgtcg
cgccagggccgtgattacgacatgagccagatcttcagcggaacgctggtggaagccgat
ccgtttcacgcggtgacgctggtcgccaatcatgacacccagccgttgcaggcgctggaa
gcgccggttgaagcctggtttaaacccctggcctatgcgctcatcctgctacgggaaaac
ggcgtgccgtcagttttctatcccgatctctatggcgcacattatgaagataccggaggc
gacggggaaacctataccattgacatgccgatcatcgagcaactcgatgaactcattctt
gcccgccagcgtttcgcccacggcattcagacgctctggtttgatcatcccaactgcatt
gcgttcagccgcagcggtacggatgacgatcccggttgcgtagtggtgttatccaatggc
gacgacggcgagaaaacactcgcgctgggcgcaaactacggtaataaaacgtggcgagat
tttctcggaaaccggagcgaaagcgtggtcacggatgagaacggtgatgccacgttttac
tgcaacgctggcagcgtaagcgtatgggtgattgaagaggtgatctag

DBGET integrated database retrieval system